OK, turing.

<- leave blank

Sun Oct 17 13:59:28 EDT 2021

---
/mnt/git/object/72d08816abaa2935e8055d9cdfd73b59df5f9bd3/tree/sys/src/libaml/aml.c
+++ sys/src/libaml/aml.c
@@ -152,7 +152,7 @@
	Oif, Oelse, Owhile, Obreak, Oret, Ocall,
	Ostore, Oderef, Osize, Oref, Ocref, Ocat,
	Oacq, Osignal, Orel, Ostall, Osleep, Oload, Ounload,
- Otodec, Otohex, Otoint,
+ Otodec, Otohex, Otoint, Otostr,
 };

 static Op optab[];
@@ -2012,6 +2012,27 @@
	return r;
 }

+static void*
+evaltostr(void)
+{
+ char *buf, *r, *e;
+ int len;
+
+ buf = FP->arg[0];
+ if(buf == nil || (TAG(buf) != 'b' && TAG(buf) != 's'))
+ buf = copy('b', buf);
+ len = ival(FP->arg[1]);
+ if(~len == 0 || len > SIZE(buf))
+ len = SIZE(buf);
+ if(len > 0 && (e = memchr(buf, 0, len)) != nil)
+ len = e - buf;
+ r = mk('s', len+1);
+ r[len] = '\0';
+ memmove(r, buf, len);
+ store(r, FP->arg[2]);
+ return r;
+}
+
 static Op optab[] = {
	[Obad] "", "", evalbad,
	[Onop] "Noop", "", evalnop,
@@ -2110,6 +2131,7 @@
	[Otodec] "ToDecimalString", "*@", evalconv,
	[Otohex] "ToHexString", "*@", evalconv,
	[Otoint] "ToInteger", "*@", evalconv,
+ [Otostr] "ToString", "*i@", evaltostr,
 };

 static uchar octab1[] = {
@@ -2132,7 +2154,7 @@
 /* 80 */ Onot, Olbit, Orbit, Oderef, Obad, Omod, Obad, Osize,
 /* 88 */ Oindex, Omatch, Ocfld4, Ocfld2, Ocfld1, Ocfld0, Obad, Ocfld8,
 /* 90 */ Oland, Olor, Olnot, Oleq, Olgt, Ollt, Obad, Otodec,
-/* 98 */ Otohex, Otoint, Obad, Obad, Obad, Obad, Obad, Obad,
+/* 98 */ Otohex, Otoint, Obad, Obad, Otostr, Obad, Obad, Obad,
 /* A0 */ Oif, Oelse, Owhile, Onop, Oret, Obreak, Obad, Obad,
 /* A8 */ Obad, Obad, Obad, Obad, Obad, Obad, Obad, Obad,
 /* B0 */ Obad, Obad, Obad, Obad, Obad, Obad, Obad, Obad,


Sun Oct 17 13:09:31 EDT 2021
RSDT� lLENOVOCB-01    � �w �w �w P�������������������CP�LENOVOCB-01  ACPI 
�w �w  � ��  P  �   e 9  2 �  � � �w         P 
  �  DSDTD� �ENOVOCB-01  ACPI  SS1_ SS2_ SS3_SS4_[�NVS
��[�0GNVSOSYSSMIFPRM0PRM1SCIFPRM2PRM3LCKFPRM4PRM5P80D
PWRSDBGSTHOFACT1ACTTPSVTTC1VTC2VTSPVCRTTDTSEDTS1DTS2DTSF      
 REVNAPICTCNTPCP0PCP1PPCMPPMF
C67LNATPCMAPCMBPLPTPFDCPCMCPCIRPSMSCW381SMC1EMAEEMAPEMALMEFEDSTSMORDTCGPPPRP
PPRQLPPRIDEMBID_PLIDBTYPOSCCNEXPSBV1SBV2
DSENGPICCTYPL01CVFN0VFN1VFN2VFN3VFN4VFN5VFN6VFN7VFN8VFN9ATMCPTMCPNHM
TBAL TBAH
RTIPTSODPFLVBREVBBIDPDTSPKGAPAMTAC0FAC1FDTS3DTS4LTR1LTR2LTR3LTR4LTR5LTR6LTR7LTR8LTR9LTRALTRBLTRCLTRDLTRELTRFLTRGLTRHLTRILTRJLTRKOBF1OBF2OBF3OBF4OBF5OBF6OBF7OBF8OBF9OBFAOBFBOBFCOBFDOBFEOBFFOBFGOBFHOBFIOBFJOBFKXTUB
XTUS XMPB
DDRFRTD3PEP0PEP3DPTFSADESACRSAHTCTDPLPMPLPMVECEUTGFGMEMDATRAPTRAMEMCMEMHFND1FND2AMBDAMATAMPTAMCTAMHTSKDESKATSKPTSKCTSKHTEFDEEFATEFPTEFCTEFHTVRDEVRATVRPTVRCTVRHTDPAPDPPPDPCPDCMPTRTVLPOELPOPLPOSLPOWLPERPPSZ
DISEBGMA@BGMSBGIAIRMCNFCECHENS0IDCTDBDKSMSIO1SIO2SPBASEC0 SEC1 SEC2
SEC3 SEC4 SEC5 SEC6 SEC7 SEC8 @iWIFDWFATWFPTWFCTWFHTPWREPWRP
@XHPRRIC0DVS0DVS1DVS2DVS3GBSXIUBEIUCEIUDEECNOAUDDIC0DIC1DIC1SVRRDPSCPI20DI21DRCG0ECDBP2MESSH0SSL0SSD0FMH0FML0FMD0FPH0FPL0FPD0SSH1SSL1SSD1FMH1FML1FMD1FPH1FPL1FPD1M0C0M1C0M2C0M0C1M1C1M2C1M0C2M1C2M0C3M1C3M0C4M1C4M0C5M1C5TBSFGIRQ
DMTPDMTDDMSHLANPSHSBPLCSPLVLGN1EG1ATG1PTG1CTG1HTGN2EG2ATG2PTG2CTG2HTWWSDCVSDSSDDINLDIFATIFPTIFCTIFHTSDWEUSBHBCV4WTV0WTV1APFUSOHPGP5FNOHPTBSEWKFNPEPC
VRSDPB1EGNIDWANDWWATWWPTWWCTWWHT
HMPL0CHGESAC3MEM3AMC3SKC3EFC3VRC3WFC3G1C3G2C3IFC3WWC3WGC3SPSTPERE
GN3EG3ATG3PTG3CTG3HTGN4EG4ATG4PTG4CTG4HTGN5EG5ATG5PTG5CTG5HTGN6EG6ATG6PTG6CTG6HTECLPG3C3G4C3G5C3G6C3TSP1TSP2TSP3TSP4TSP5TSP6TSP7TSP8SSP1SSP2SSP3SSP4SSP5SSP6SSP7SSP8MEMS
HS1DES1ATS1PTS1CTS1HTS2DES2ATS2PTS2CTS2HTS3DES3ATS3PTS3CTS3HTS4DES4ATS4PTS4CTS4HTS5DES5ATS5PTS5CTS5HTS6DES6ATS6PTS6CTS6HTS7DES7ATS7PTS7CTS7HTS1S3S2S3S3S3S4S3S5S3S6S3S7S3PSMEPDT1PLM1PTW1PDT2PLM2PTW2DDT1DDP1DLI1DPL1DTW1DMI1DMA1DMT1DDT2DDP2DLI2DPL2DTW2DMI2DMA2DMT2WIFEDOM1LIM1TIM1DOM2LIM2TIM2DOM3LIM3TIM3TRD0TRL0TRD1TRL1WDM1CID1WDM2CID2
APPEMPL1MPL2SDS0SDS1SDS2SDS3SDS4SDS5SDS6SDS7SDS8SDS9SDSATPLBTPLHWTVXWITXGPTDGDBTUTKXSPTDGEXNTBTSAICSTARSFPATFPENFPGN
FPLVCPADCPABTNATCPGN CF2TATLB
SDM0SDM1SDM2SDM3SDM4SDM5SDM6SDM7SDM8SDM9SDMAUSTPSSHISSLISSDIFMHIFMLIFMDIFPHIFPLIFPDIM0CIM1CIM0CSM1CSM0CUM1CUCAMTDS4DIVDFEIDFGFPS
GFPI GNSMGNSCGGNR GBTW GBTK GBTI GPDI GPLI
CL00CL01CL02CL03L0ENL1ENL2ENL3ENCDIVC0TPC0CVC0GPC0IBC0IAC0P0C0P1C0P2C0P3C0G0C0G1C0G2C0G3C0F0C0F1C0F2C0F3C0A0C0A1C0A2C0A3C0I0C0I1C0I2C0I3C0PLC1TPC1CVC1GPC1IBC1IAC1P0C1P1C1P2C1P3C1G0C1G1C1G2C1G3C1F0C1F1C1F2C1F3C1A0C1A1C1A2C1A3C1I0C1I1C1I2C1I3C1PLC2TPC2CVC2GPC2IBC2IAC2P0C2P1C2P2C2P3C2G0C2G1C2G2C2G3C2F0C2F1C2F2C2F3C2A0C2A1C2A2C2A3C2I0C2I1C2I2C2I3C2PLC3TPC3CVC3GPC3IBC3IAC3P0C3P1C3P2C3P3C3G0C3G1C3G2C3G3C3F0C3F1C3F2C3F3C3A0C3A1C3A2C3A3C3I0C3I1C3I2C3I3C3PLL0SML0H0L0H1L0H2L0H3L0H4L0H5L0H6L0H7L0H8L0PLL0M0L0M1L0M2L0M3L0M4L0M5L0M6L0M7L0M8L0M9L0MAL0MBL0MCL0MDL0MEL0MFL0DIL0BSL0A0L0A1L0A2L0A3L0A4L0A5L0A6L0A7L0A8L0A9L0AAL0ABL0D0L0D1L0D2L0D3L0D4L0D5L0D6L0D7L0D8L0D9L0DAL0DBL0DVL0CVL0LUL0NLL0EEL0VCL0FSL0DGL0C0L0C1L0C2L0C3L0CK
L0CLL1SML1H0L1H1L1H2L1H3L1H4L1H5L1H6L1H7L1H8L1PLL1M0L1M1L1M2L1M3L1M4L1M5L1M6L1M7L1M8L1M9L1MAL1MBL1MCL1MDL1MEL1MFL1DIL1BSL1A0L1A1L1A2L1A3L1A4L1A5L1A6L1A7L1A8L1A9L1AAL1ABL1D0L1D1L1D2L1D3L1D4L1D5L1D6L1D7L1D8L1D9L1DAL1DBL1DVL1CVL1LUL1NLL1EEL1VCL1FSL1DGL1C0L1C1L1C2L1C3L1CK
L1CLL2SML2H0L2H1L2H2L2H3L2H4L2H5L2H6L2H7L2H8L2PLL2M0L2M1L2M2L2M3L2M4L2M5L2M6L2M7L2M8L2M9L2MAL2MBL2MCL2MDL2MEL2MFL2DIL2BSL2A0L2A1L2A2L2A3L2A4L2A5L2A6L2A7L2A8L2A9L2AAL2ABL2D0L2D1L2D2L2D3L2D4L2D5L2D6L2D7L2D8L2D9L2DAL2DBL2DVL2CVL2LUL2NLL2EEL2VCL2FSL2DGL2C0L2C1L2C2L2C3L2CK
L2CLL3SML3H0L3H1L3H2L3H3L3H4L3H5L3H6L3H7L3H8L3PLL3M0L3M1L3M2L3M3L3M4L3M5L3M6L3M7L3M8L3M9L3MAL3MBL3MCL3MDL3MEL3MFL3DIL3BSL3A0L3A1L3A2L3A3L3A4L3A5L3A6L3A7L3A8L3A9L3AAL3ABL3D0L3D1L3D2L3D3L3D4L3D5L3D6L3D7L3D8L3D9L3DAL3DBL3DVL3CVL3LUL3NLL3EEL3VCL3FSL3DGL3C0L3C1L3C2L3C3L3CK
L3CLECR1 (I2SCODV0ODV1ODV2ODV3ODV4ODV5UBCB EMODWIFC
8TPLSTPDBTPDHTPDSAG1L@AG1H@AG2L@AG2H@AG3L@AG3H@HEFEXDCE
HCCMDCOMDLPT1PSTPWKMDIDERPIE0PIE1CSTSPMEEWOLENVAD NVSZ
S1C0S1C1S2C0S2C1P2KBHRAMMDENTBEPFGNETBTCTRPNTBTM [�GNS ��
[�OGNSOG00OG01OG02OG03OG04OG05OG06OG07OG08OG09OG10ECON�_SB_PR00O!�
LNKA �LNKB �
LNKC �
LNKD � LNKA �LNKB �
LNKC �
LNKD � LNKA �LNKB �
LNKC �
LNKD � LNKA �LNKB �
LNKC �
LNKD � LNKA � LNKA �LNKB �
LNKC �
LNKD � LNKA �LNKB �
LNKC �
LNKD � LNKA �LNKB �
LNKC �
LNKD � LNKA � LNKA � LNKA � LNKA AR00B#-�
�
�

�

�
�
�

�

�
�
�

�

�
�
�

�

�
�
�

�

�
 �
!�

"�
�
�
�

�

�
�
�

�

�
�
�

�

�
�
�
�

�

�
�
�
�
PR044�NKA �NKB �LNKC �LNKD AR04, �
 �

�

�
PR054�NKB �NKC �LNKD �LNKA AR05, �
 �

�

�
PR064�NKC �NKD �LNKA �LNKB AR06, �
 �

�

�
PR074�NKD �NKA �LNKB �LNKC AR07, �
 �

�

�
PR084�NKA �NKB �LNKC �LNKD AR08, �
 �

�

�
PR094�NKB �NKC �LNKD �LNKA AR09, �
 �

�

�
PR0E4�NKC �NKD �LNKA �LNKB AR0E, �
 �

�

�
PR0F4�NKD �NKA �LNKB �LNKC AR0F, �
 �

�

�
PR024�NKA �NKB �LNKC �LNKD AR02, �
 �

�

�
PR0A4�NKB �NKC �LNKD �LNKA AR0A, �
 �

�

�
PR0B4�NKC �NKD �LNKA �LNKB AR0B, �
 �

�

�
PRSA
#x�y
PRSAPRSBPRSAPRSCPRSAPRSDPRSAPRSEPRSAPRSFPRSAPRSGPRSAPRSH[��CI0_HIDA�_CIDA�_ADR
 ^BN00 �_BBN �N00_UID _PRT �PICM�R00�R00[�BUS  [�HBUS @ EPEN EPBR
MHEN MHBR GCLK D0END1F2D1F1D1F0 LPXENPXSZ PXBR DIEN DIBR MEBR
@PMLK PM0H PM1L PM1H PM2L PM2H PM3L PM3H PM4L PM4H PM5L
PM5H PM6L PM6H  H TUUD I TLUD @ HTSEBUF0A"�  � �  �
�G��  � � 
 �  �   � @ �  @ � @ �  � � @ �  � � @ �  � @ �  @ � @ �  � � @ �
  � � @ �   � @ �  @ � @ �  � � @ �  � � @ �   �  �  � �   �
  �  �� �y EP_B MH_B PC_B PC_L DM_B GEPB��P_B yEPBR
EP_B�P_BGMHB��H_B yMHBR
MH_B�H_BGPCB��C_B yPXBR
PC_B�C_B!GPCL��C_L z PXSZPC_L�C_LGDMB��M_B yDIBR
DM_B�M_B@7_CRSpGPCL`�UF0

PBMXptz`

 PBMX�UF0
PBLNptz`
  PBLN�PM1L�UF0
|C0LNp C0LN��M1L�UF0XC0RWp C0RW�PM1H�UF0
�4LNp C4LN��M1H�UF0(C4RWp C4RW�PM2L�UF0
�8LNp C8LN��M2L�UF0�RWp C8RW�PM2H�UF0
�CLNp CCLN��M2H�UF0�CCRWp CCRW�PM3L�UF0
�LNp D0LN��M3L�UF0�D0RWp D0RW�PM3H�UF0
�Np D4LN��M3H�UF0hD4RWp D4RW�PM4L�UF0D8LNp D8LN��M4L�UF08D8RWp
D8RW�PM4H�UF02DCLNp DCLN��M4H�UF0 DCRWp DCRW�PM5L�UF0LE0LNp
E0LN��M5L�UF0�E0RWp E0RW�PM5H�UF0fE4LNp E4LN��M5H�UF0�E4RWp
E4RW�PM6L�UF0�E8LNp E8LN��M6L�UF0xE8RWp E8RW�PM6H�UF0�ECLNp
ECLN��M6H�UF0HECRWp ECRW�PM0H�UF0�F0LNp F0LN��M0H�UF0F0RWp
F0RW�UF0�M1MN�UF0�M1MX�UF0�M1LNpM32LM1LNpM32BM1MNtrM1MNM1LN M1MX��64L
�UF0�LNp MSLN��UF0�LN�UF0�2MN�UF0�2MXpM64LM2LNpM64BM2MNtrM2MNM2LN
M2MX�UF0GUID
[M���tA��SUPP CTRL XCNT O_OSCpk`� CDW1�
CDW2�
CDW3� �hGUIDNEXPpCDW2SUPPpCDW3CTRL��TBTS�NAT{CTRL�CTRL��CDW1 �{CTRL
NHPG�{CTRL
 NPME��i}CDW1
CDW1��CDW3CTRL}CDW1
CDW1pCTRLCDW3pCTRLOSCC��}CDW1
CDW1�G\._SB_PCI0AR00 �^AR00PR00 �^PR00AR02 �^AR02PR02 �^PR02AR04
�^AR04PR04 �^PR04AR05 �^AR05PR05 �^PR05AR06 �^AR06PR06 �^PR06AR07
�^AR07PR07 �^PR07AR08 �^AR08PR08 �^PR08AR09 �^AR09PR09 �^PR09AR0A
�^AR0APR0A �^PR0AAR0B �^AR0BPR0B �^PR0B[�PEG0_ADR  [�PEGP_ADR [�PEG1_ADR
 [�PEGP_ADR [�PEG2_ADR  [�PEGP_ADR [�GFX0_ADR 
[�B0D4_DSM�PCICh�CIDhijk_ADR  ��CR1G._SB_PCI0PCIG
��S5zM���MBPCID��PCIG��i
�� �
��
���
	�P��� %._SB_PCI0PCIC ��CR1��PCIG��PNVB��NVL[�NVA
	PNVBPNVL[�>PNVARCRV PCHSPCHGRPA1 RPA2 RPA3 RPA4 RPA5 RPA6 RPA7 RPA8
	RPA9 RPAA RPAB RPAC RPAD RPAE RPAF RPAG RPAH RPAI RPAJ RPAK NHLA@NHLL
	ADFM SBRG GPEM G2L0 G2L1 G2L2 G2L3 G2L4 G2L5 G2L6 G2L7 G2L8 G2L9
	PML1PML2PML3PML4PML5PML6PML7PML8PML9PMLAPMLBPMLCPMLDPMLEPMLFPMLGPMLHPMLIPMLJPMLKPNL1PNL2PNL3PNL4PNL5PNL6PNL7PNL8PNL9PNLAPNLBPNLCPNLDPNLEPNLFPNLGPNLHPNLIPNLJPNLKU0C0
	U1C0 ADPM XHPCXRPCXSPCXSPAHPTB
	HPTESMD0SMD1SMD2SMD3SMD4SMD5SMD6SMD7SMD8SMD9SMDASIR0SIR1SIR2SIR3SIR4SIR5SIR6SIR7SIR8SIR9SIRASB00
	SB01 SB02 SB03 SB04 SB05 SB06 SB07 SB08 SB09 SB0A SB10 SB11 SB12 SB13 SB14
	SB15 SB16 SB17 SB18 SB19 SB1A
	GPENSGIRNIT1NIT2NIT3NPM1NPM2NPM3NPC1NPC2NPC3NL11NL12NL13ND21ND22ND23ND11
	ND12 ND13 NLR1NLR2NLR3NLD1 NLD2 NLD3
	NEA1NEA2NEA3NEB1NEB2NEB3NEC1NEC2NEC3NRA1NRA2NRA3NMB1 NMB2 NMB3
	NMV1 NMV2 NMV3 NPB1 NPB2 NPB3 NPV1 NPV2 NPV3 SXRB SXRS
	CIOECIOITAENTIRQXWMB
	EMH4CSKUITA0ITA1ITA2ITA3ITS0ITS1ITS2ITS3D�SB_GCOMC* �
	� � � � � � �4
 � � � � � � � � � �GPPG,


















PCFG> � �� � 
 � ����h  HOWN,
��������

�������
��POWN,

0

0
@

0
 


,

,
8
@
L
X

 GPEO>@D@DH@D@
@D@DHLPT@@GPES
 RXEV
���GNUMpGNMBhapGGRPhb�awb
 IINUM��CHS
p `�p`pGNMBhapGGRPhbp c��br��GPPG` c aauc�
�
` GGRP z{h �`�GNMB �h�;GGPEpGGRPh`pGNMBhap{zGPEMw`

 b�� �o��wtb
  a ;GADR��CHS
p `�p`pr��GCOM` h SBRG ap��i` h b�ab CGPC0 pGGRPh`pGNMBhaprGADR`PCFGwa
 b[�DW0 b
[�PDW0 TEMP �EMPDSPC0
pGGRPh`pGNMBhaprGADR`PCFGwa
 b[�DW0 b
[�PDW0 TEMP piTEMPGGPC1 pGGRPh`pGNMBhaprrGADR`PCFGwa

 b[�DW1 b
[�PDW1 TEMP �EMPHSPC1
pGGRPh`pGNMBhaprrGADR`PCFGwa

 b[�DW1 b
[�PDW1 TEMP piTEMPHSRXO
pGGRPh`pGNMBhaprGADR`PCFGwa
 b[�DW0 b
[�PDW0 TEMP piTEMPGGGIV pGGRPh`pGNMBhaprGADR`PCFGwa
 b[�DW0 b
[�PDW0 TEMP �EMPEGGOV pGGRPh`pGNMBhaprGADR`PCFGwa
 b[�DW0 b
[�PDW0 TEMP �EMPFSGOV
pGGRPh`pGNMBhaprGADR`PCFGwa
 b[�DW0 b
[�PDW0 TEMP piTEMPGGGII pGGRPh`pGNMBhaprGADR`PCFGwa
 b[�DW0 b
[�PDW0 TEMP �EMPHSGII
pGGRPh`pGNMBhaprGADR`PCFGwa
 b[�DW0 b
[�PDW0 TEMP piTEMPGGPMV pGGRPh`pGNMBhaprGADR`PCFGwa
 b[�DW0 b
[�PDW0
TEMP �EMPHSPMV
pGGRPh`pGNMBhaprGADR`PCFGwa
 b[�DW0 b
[�PDW0
TEMP piTEMP>GHPO pGGRPh`pGNMBha[�REG GADR`HOWN
[�PREG TEMP �zTEMPa  ISHPO
pGGRPh`pGNMBha[�REG GADR`HOWN
[�PREG TEMP }{TEMP�a yia TEMPFGGPO pGGRPh`pGNMBhaprGADR`POWNwza

 b[�REG b
[�PREG TEMP �zTEMPw{a


 HSGRA
pGGRPh`pGNMBhaprGADR`PCFGwa
 b[�DW0 b
[�PDW0 TEMP piTEMPLSGWP
pGGRPh`pGNMBhaprrGADR`PCFGwa

 b[�DW0 b
[�PDW0
TEMP piTEMPNUGP1 [�PPX GADRhGPEO
$[�GPPX STSX @GENX ��zGPEMwh

 p{STSXGENX �PESh �p �PESh "UGPS��CHSp

`�p
`�`v`UGP1`>CGP1
��zGPEMwh

 [�PPX GADRhGPEO
[�GPPX STSX piSTSX'CGPS��CHSp

`�p
`�`v`CGP1`�ECGLS��CHSp

`�p
`� `v`��
	pG2L9a���
pG2L8a���
pG2L7a���
pG2L6a���
pG2L5a���
pG2L4a���
pG2L3a���
pG2L2a���pG2L1a��� pG2L0a��GP1`aLCAGS pGGRPh`pGNMBha��zGPEMw`

 [�PPX GADR`GPEO
[�GPPX STSX pSTSXcyab}STSXbSTSX#ISMEpGGRPh`pGNMBha�z�GPES` a  MDIPI
pGGRPh`pGNMBhaprGADR`PCFGwa
 b[�DW0 b
[�PDW0 RDIS RCFG ��RCFG
p�RXEV` c{c�
wa
 c}cyRCFGwa
 �XEV` p
RCFGpRDISAUIPI pGGRPh`pGNMBhaprGADR`PCFGwa
 b[�DW0 b
[�PDW0 RDIS RCFG p{z�RXEV` wa

 c��c
p RDISpcRCFGM\ -THEN[�HBA  ��THBADO00 ��O00�'THDA
p �w
@w
�h
  `r`w
@i `�8STRD��ij ���cp `p a��jp�cria br`ybw
a `ua�MTHDS ��HEN�p�`pTHDA

a[�HBA a
@[�THBAQO00@[�THBADO00 @DO10 @DO30 [�THBAWO00[�THBABO00pB DO10p`WO00p
fp`g��g
pSTRDhf
QO00rf
ftg
g��g
pSTRDhf
DO00rf
ftg
g��g
pSTRDhf
WO00rf
ftg
g��gpSTRDhfBO00rfftggp DO30THDH THDS� THDD THDS� SPTHSPTL
#PCHV ��CHS�PTH��CHS
�PTL�J_GPEC_L6D\/_SB_PCI0XHC_GPEH\/_SB_PCI0HDASGPEH\/_SB_PCI0GLANGPEH\/_SB_PCI0XDCIGPEHIv._SB_PCI0[�
PRRE_HIDA�_UIDPCHRESV _STA
L_CRSBUF0J
V�  � �  �  �  � P �  � �  `� �  �� �  A� y
�UF0[�IOTR_HIDA�_UIDIoTraps I_CRS p
y `BUF0

G �BUF1

G �BUF2

G �BUF3

G �BUF0
AMI0�UF0
AMA0�UF1
AMI1�UF1
AMA1�UF2
AMI2�UF2
AMA2�UF3
AMI3�UF3
AMA3pITA0AMI0pITA0AMA0pITA1AMI1pITA1AMA1pITA2AMI2pITA2AMA2pITA3AMI3pITA3AMA3��TS0�BUF0`��TS1�BUF1`��TS2�BUF2`��TS3�BUF3`�[�LPCB_ADR
 _DSM�PCICh�CIDhijk�[�PC_  [�LPC_ CDID CRID H;IOD0IOD1 @ PRBL F 
XUSB O GR0B  GR19  @ ESPI[�PPMC_ADR  _DSM�PCICh�CIDhijk�[�MCB
 [�PMCB VDID @ ACBA 0 PWBA[�HSBUS_ADR  _DSM�PCICh�CIDhijk�[�MBP
��SMBP @ SBAR @ I2CE M TCOB[�MBIySBAR

[�SMBIHSTS HCONHCOMTXSADAT0DAT1HBDRPECRRXSASDATDSSXB
�STRT�p I2CEp
�STSphTXSApiHCOMp
HHCON�COMP}HSTS
�S��HSRXB �STRT��I2CEp
�STSp}h TXSAp
DHCON�COMP}HSTS
�S�AT0��SWRB�STRT�p I2CEp
�STSphTXSApiHCOMpjDAT0p
HHCON�COMP}HSTS
�S��NSRDB
�STRT��I2CEp
�STSp}h TXSApiHCOMp
HHCON�COMP}HSTS
�S�AT0��SWRW�STRT�p I2CEp
�STSphTXSApiHCOM{j
�1{zj

�0p
LHCON�COMP}HSTS
�S��JSRDW
�STRT��I2CEp
�STSp}h TXSApiHCOMp
LHCON�COMP}HSTS
�S�yDAT0
 DAT1 ��J SBLW�STRT�pkI2CEp
�STSphTXSApiHCOMp�DAT0p ap�j HBDRp
THCON��jap�`��{HSTS
�`v`[!
2��KILL�p
�STSua��jap�ja HBDR�COMP}HSTS
�S��@SBLRTBUF �STRT�pjI2CEp
�STSp}h TXSApiHCOMp
THCONp�`��{HSTS
�`v`[!
2��KILL�pDAT0�BUF p
�STSpa���TBUF p�`��{HSTS
�`v`[!
2��KILL�pHBDR�BUFa p
�STSua�COMP}HSTS
�S�BUF�OSTRTp
��`�{HSTS
@ v`["�� ��p `p�`�`�{HSTS v`[!
2�� KILL���-COMPp�`�`�{HSTS
 ��v`[!
2�� KILL�KILL}HCON
HCON}HSTS
�SMR_SB_[�
LNKA_HIDA�_UID_DIS}PARC
�ARC_PRS�RSA8_CRSRTLA
# y �TLAIRQ0p IRQ0y{PARC
 IRQ0�TLA_SRS �IRQ0�RQ0`v`p`PARC_STA�{PARC
�� ��[�
LNKB_HIDA�_UID
_DIS}PBRC
�BRC_PRS�RSB8_CRSRTLB
# y �TLBIRQ0p IRQ0y{PBRC
 IRQ0�TLB_SRS �IRQ0�RQ0`v`p`PBRC_STA�{PBRC
�� ��[�
LNKC_HIDA�_UID
_DIS}PCRC
�CRC_PRS�RSC8_CRSRTLC
# y �TLCIRQ0p IRQ0y{PCRC
 IRQ0�TLC_SRS �IRQ0�RQ0`v`p`PCRC_STA�{PCRC
�� ��[�
LNKD_HIDA�_UID
_DIS}PDRC
�DRC_PRS�RSD8_CRSRTLD
# y �TLDIRQ0p IRQ0y{PDRC
 IRQ0�TLD_SRS �IRQ0�RQ0`v`p`PDRC_STA�{PDRC
�� ��[�
LNKE_HIDA�_UID
_DIS}PERC
�ERC_PRS�RSE8_CRSRTLE
# y �TLEIRQ0p IRQ0y{PERC
 IRQ0�TLE_SRS �IRQ0�RQ0`v`p`PERC_STA�{PERC
�� ��[�
LNKF_HIDA�_UID
_DIS}PFRC
�FRC_PRS�RSF8_CRSRTLF
# y �TLFIRQ0p IRQ0y{PFRC
 IRQ0�TLF_SRS �IRQ0�RQ0`v`p`PFRC_STA�{PFRC
�� ��[�
LNKG_HIDA�_UID
_DIS}PGRC
�GRC_PRS�RSG8_CRSRTLG
# y �TLGIRQ0p IRQ0y{PGRC
 IRQ0�TLG_SRS �IRQ0�RQ0`v`p`PGRC_STA�{PGRC
�� ��[�
LNKH_HIDA�_UID
_DIS}PHRC
�HRC_PRS�RSH8_CRSRTLH
# y �TLHIRQ0p IRQ0y{PHRC
 IRQ0�TLH_SRS �IRQ0�RQ0`v`p`PHRC_STA�{PHRC
�� ��C+\ PMBV /PMBS ��MBV py\/_SB_PCI0PPMCACBA
 PMBV�MBVPWRV /PWRM ��WRV py\/_SB_PCI0PPMCPWBA
 PWRV�WRVTCBV /TCBS ��CBV py\/_SB_PCI0SBUSTCOB
 TCBV�CBV[�MIOPMBS
��PMIO PBSS G GPEC[�MLPrPMBS
�
 [�PMLP @ GE08 GE17 GE35 GE45 GE48 GE51 L[�PMLPA GS08 GS17
 GS35 GS45 GS48 GS51 GS54GS55 H[�CBATCBS
[�TCBA CPSC[�WMR PWRM [�PWMR @p DWLEHWLE[�MST PWRV
��PMST @ USBP  PMFS MPMC UWAB1PCRR
ryh
 i`rSBRG``[�CR0 `
[�PCR0DAT0 �AT0JPCRWryh
 i`rSBRG``[�CR0 `
[�PCR0DAT0 pjDAT0[�CR1 rSBRG4�
[�PCR1DAT1 pDAT1aPCROpPCRRhi`p}`j aPCRWhiaPCRApPCRRhi`p{`j
aPCRWhiaPCAOpPCRRhi`p}{`j k aPCRWhiaO._SB_PCI0LTRN OBFN LMSL LNSL [�
GLAN_ADR  _DSM�PCICh�CIDhijk�[�LBA  [�GLBA DVID @e PMEE PMES_PRW
�PRW
m
_DSWphPMEE*GPEH ��VID���MEEPMESpPMES�LAN
H[._SB_PCI0[�ZXHC__ADR  [�PRT  [�XPRT DVID @9D0D3 PMEE PMES @
MW13MW14  MB13MB14  @PR2_ PR2M PR3_ PR3M XFLT <_DSM�PCICh�CIDhijk��
�4���+4�#��
piXFLT� _S3D � _S4D � _S3W � _S4W �_S0W ��FLT ���_PRW �PRW
m
_DSWphPMEE,_INI �[\/_SB_PCI0XHC_RHUBINIR ^.RHUBINIR-GPEH
��VID�pPMES`pPMES��MEE`�HC_
[�HCP rGPCB
  [�XHCP PDBM @MEMB@USRA��CHVSPTH���SSPA��CHVSPTH���XRST
 J_PS0��VID�pMEMBbpPDBMa{PDBM��PDBMpD0D3cp D0D3pXWMBMEMB}a
PDBM[�C11 XWMB ��MC11 �@ UPSWp
UPSW{PDBM��PDBMpbMEMBpaPDBM�[\/_SB_PCI0XHC_PS0X PS0X��WAB�D0D3 �^.XDCID0I3
pMPMC�PMFS["

O_PS3��VID�pMEMBbpPDBMa{PDBM��PDBMp D0D3pXWMBMEMB}a
PDBM[�C11 XWMB ��MC11 �@ UPSWp
UPSW{PDBM��PDBMp
D0D3pbMEMBpaPDBM�[\/_SB_PCI0XHC_PS3X PS3X��WAB�D0D3
�^^.XDCID0I3
�^.XDCIDVID�MPMC�PMFS["

"CUID ��
����Pj$#���[�RHUB_ADR 2_PS0��VID��[\/_SB_PCI0XHC_RHUBPS0X
PS0X2_PS2��VID��[\/_SB_PCI0XHC_RHUBPS2X
PS2X2_PS3��VID��[\/_SB_PCI0XHC_RHUBPS3X PS3X[�HS01_ADR[�HS02_ADR
[�HS03_ADR
[�HS04_ADR
[�HS05_ADR
[�HS06_ADR
[�HS07_ADR
[�HS08_ADR
[�HS09_ADR
	[�HS10_ADR

[�USR1_ADR �USRA [�USR2_ADR �USRA [�SS01_ADR �SSPA [�SS02_ADR �SSPA
[�SS03_ADR �SSPA
 [�SS04_ADR �SSPA
 [�SS05_ADR �SSPA
 [�SS06_ADR �SSPA
 ��CHVSPTHH
/_SB_PCI0XHC_RHUB[�HS11_ADR
[�HS12_ADR
[�HS13_ADR
[�HS14_ADR
[�SS07_ADR �SSPA
 [�SS08_ADR �SSPA
 [�SS09_ADR �SSPA
 [�SS10_ADR �SSPA
	 N2._SB_PCI0[�2XDCI_ADR  [�TGD  [�OTGDDVID @XDCB@ @.D0I3 N
	 PMEE PMESXDBA �XDCB ��D _DSM_T_0 �PCICh�CIDhijk��
Յ+s�J�K��K��pj_T_0��T_0 �s���T_0����T_0
[�DBW XDBA  [�XDBW �| U2CPU3CP 4PUPS PURC   UXPE p�k a�� p UXPEp
PURCp `��

[!
du`p PUPSp `���[!
d��U2CP �3CP �`��U2CP ��U3CP ���
��U2CP ��U3CP p
PUPSp `���[!
d��U2CP
�3CP
�`��U2CP
��U3CP
pPURCp
UXPE����T_0
����T_0
[�DBD XDBA  [�XDBD �c CSFR [�DW2 XDBA  [�XDW2 �| OTHC��THC pCSFRp `��
d��SFR �"�� _DDNSPT XHCI controller _STR+
(S P T X H C I c o n t r o l l e r  _S0W �_STA ��DVID����_PRW �PRW
m
_DSWphPMEE-GPEH ��VID�pPMES`pPMES��MEE`�DCI
�._SB_PCI0[�)HDAS_ADR  [�DAR  [�HDARVDID @" MBCG I PMEE
PMES_S0W
_DSWphPMEE_PRW �PRW
m
;GPEH ��DID����MEEPMESADBGHDAS GPEH pPMES�DAS
NBUF3
0�  y HAUWA��CHS��^.LPCBCRID ����^.LPCBCRID ���^.LPCBCRID���^.LPCBCRID
	��G_INI ADBGHDAS _INI �BUF
NBAS�BUF
NMAS�BUF
&NLENpNHLANBASrNHLAtNHLL NMASpNHLLNLEN��UWAp MBCGF_DSM_T_0 ADBGHDAS _DSM
�PCICh�CIDhijk��
n��l��{]��� pj_T_0��T_0 ����T_0ADBG_DSM Fun 1 NHLT �BUF���T_0
ADBG_DSM Fun 2 FMSK �DFM���T_0
ADBG_DSM Fun 3 PPMS ��ADBG_DSM Fun NOK � �DBG_DSM UUID NOK [�7RP01_ADR ��RPA1
�PA1��  *_INI pLTR1LTRNpPML1LMSLpPNL1LNSLpOBF1OBFN[�XCS �[�PXCS VDID @&L0SE
LDIS   LASX 2ABPX PDCX PDSX  ( PSPX O D3HT N HPEXPMEX 0
L23EL23R � LEDM[�PXCS@ @n HPSXPMSXLTRV J _DSM_T_0 ��
��S5zM���M�p� _T_0��T_0 OPTS
 �PTS FUN0�PTS
FUN4�PTS
FUN6�PTS
FUN8�PTS
	FUN9��i
pFUN0�LTREpFUN6�OBFFpFUN4��CR1��i
pFUN8pFUN9�PTS���T_0
��i
�OBFN�
  ��
 ���T_0
�
�i
� LTRN��LMSL �NSL ��CHSSPTHpFLMSLpFLNSL���CHSSPTLpLMSLpLNSLp{zLMSL


 �TRV p{LMSL�LTRV p{zLNSL


 �TRV
 p{LNSL�LTRV
 �TRV�����T_0
��CR1��i
����T_0
	��CR1��i
�P��� [�PXSX_ADR _PRW �PRW
i
-HPME�PMSXp
��`pPMSX�PMSXv`�p `�XSX
_PRW �PRW
i
_PRT �PICM�R04�R04[�7RP02_ADR ��RPA2 �PA2��  *_INI
pLTR2LTRNpPML2LMSLpPNL2LNSLpOBF2OBFN[�XCS �[�PXCS VDID @&L0SE LDIS   LASX
2ABPX PDCX PDSX  ( PSPX O D3HT N HPEXPMEX 0 L23EL23R �
LEDM[�PXCS@ @n HPSXPMSXLTRV J _DSM_T_0 ��
��S5zM���M�p� _T_0��T_0 OPTS
 �PTS FUN0�PTS
FUN4�PTS
FUN6�PTS
FUN8�PTS
	FUN9��i
pFUN0�LTREpFUN6�OBFFpFUN4��CR1��i
pFUN8pFUN9�PTS���T_0
��i
�OBFN�
  ��
 ���T_0
�
�i
� LTRN��LMSL �NSL ��CHSSPTHpFLMSLpFLNSL���CHSSPTLpLMSLpLNSLp{zLMSL


 �TRV p{LMSL�LTRV p{zLNSL


 �TRV
 p{LNSL�LTRV
 �TRV�����T_0
��CR1��i
����T_0
	��CR1��i
�P��� [�PXSX_ADR _PRW �PRW
i
-HPME�PMSXp
��`pPMSX�PMSXv`�p `�XSX
_PRW �PRW
i
_PRT �PICM�R05�R05[�7RP03_ADR ��RPA3 �PA3��  *_INI
pLTR3LTRNpPML3LMSLpPNL3LNSLpOBF3OBFN[�XCS �[�PXCS VDID @&L0SE LDIS   LASX
2ABPX PDCX PDSX  ( PSPX O D3HT N HPEXPMEX 0 L23EL23R �
LEDM[�PXCS@ @n HPSXPMSXLTRV J _DSM_T_0 ��
��S5zM���M�p� _T_0��T_0 OPTS
 �PTS FUN0�PTS
FUN4�PTS
FUN6�PTS
FUN8�PTS
	FUN9��i
pFUN0�LTREpFUN6�OBFFpFUN4��CR1��i
pFUN8pFUN9�PTS���T_0
��i
�OBFN�
  ��
 ���T_0
�
�i
� LTRN��LMSL �NSL ��CHSSPTHpFLMSLpFLNSL���CHSSPTLpLMSLpLNSLp{zLMSL


 �TRV p{LMSL�LTRV p{zLNSL


 �TRV
 p{LNSL�LTRV
 �TRV�����T_0
��CR1��i
����T_0
	��CR1��i
�P��� [�PXSX_ADR _PRW �PRW
i
-HPME�PMSXp
��`pPMSX�PMSXv`�p `�XSX
_PRW �PRW
i
_PRT �PICM�R06�R06[�7RP04_ADR ��RPA4 �PA4��  *_INI
pLTR4LTRNpPML4LMSLpPNL4LNSLpOBF4OBFN[�XCS �[�PXCS VDID @&L0SE LDIS   LASX
2ABPX PDCX PDSX  ( PSPX O D3HT N HPEXPMEX 0 L23EL23R �
LEDM[�PXCS@ @n HPSXPMSXLTRV J _DSM_T_0 ��
��S5zM���M�p� _T_0��T_0 OPTS
 �PTS FUN0�PTS
FUN4�PTS
FUN6�PTS
FUN8�PTS
	FUN9��i
pFUN0�LTREpFUN6�OBFFpFUN4��CR1��i
pFUN8pFUN9�PTS���T_0
��i
�OBFN�
  ��
 ���T_0
�
�i
� LTRN��LMSL �NSL ��CHSSPTHpFLMSLpFLNSL���CHSSPTLpLMSLpLNSLp{zLMSL


 �TRV p{LMSL�LTRV p{zLNSL


 �TRV
 p{LNSL�LTRV
 �TRV�����T_0
��CR1��i
����T_0
	��CR1��i
�P��� [�PXSX_ADR _PRW �PRW
i
-HPME�PMSXp
��`pPMSX�PMSXv`�p `�XSX
_PRW �PRW
i
_PRT �PICM�R07�R07[�7RP05_ADR ��RPA5 �PA5��  *_INI
pLTR5LTRNpPML5LMSLpPNL5LNSLpOBF5OBFN[�XCS �[�PXCS VDID @&L0SE LDIS   LASX
2ABPX PDCX PDSX  ( PSPX O D3HT N HPEXPMEX 0 L23EL23R �
LEDM[�PXCS@ @n HPSXPMSXLTRV J _DSM_T_0 ��
��S5zM���M�p� _T_0��T_0 OPTS
 �PTS FUN0�PTS
FUN4�PTS
FUN6�PTS
FUN8�PTS
	FUN9��i
pFUN0�LTREpFUN6�OBFFpFUN4��CR1��i
pFUN8pFUN9�PTS���T_0
��i
�OBFN�
  ��
 ���T_0
�
�i
� LTRN��LMSL �NSL ��CHSSPTHpFLMSLpFLNSL���CHSSPTLpLMSLpLNSLp{zLMSL


 �TRV p{LMSL�LTRV p{zLNSL


 �TRV
 p{LNSL�LTRV
 �TRV�����T_0
��CR1��i
����T_0
	��CR1��i
�P��� [�PXSX_ADR _PRW �PRW
i
-HPME�PMSXp
��`pPMSX�PMSXv`�p `�XSX
_PRW �PRW
i
_PRT �PICM�R04�R04[�7RP06_ADR ��RPA6 �PA6��  *_INI
pLTR6LTRNpPML6LMSLpPNL6LNSLpOBF6OBFN[�XCS �[�PXCS VDID @&L0SE LDIS   LASX
2ABPX PDCX PDSX  ( PSPX O D3HT N HPEXPMEX 0 L23EL23R �
LEDM[�PXCS@ @n HPSXPMSXLTRV J _DSM_T_0 ��
��S5zM���M�p� _T_0��T_0 OPTS
 �PTS FUN0�PTS
FUN4�PTS
FUN6�PTS
FUN8�PTS
	FUN9��i
pFUN0�LTREpFUN6�OBFFpFUN4��CR1��i
pFUN8pFUN9�PTS���T_0
��i
�OBFN�
  ��
 ���T_0
�
�i
� LTRN��LMSL �NSL ��CHSSPTHpFLMSLpFLNSL���CHSSPTLpLMSLpLNSLp{zLMSL


 �TRV p{LMSL�LTRV p{zLNSL


 �TRV
 p{LNSL�LTRV
 �TRV�����T_0
��CR1��i
����T_0
	��CR1��i
�P��� [�PXSX_ADR _PRW �PRW
i
-HPME�PMSXp
��`pPMSX�PMSXv`�p `�XSX
_PRW �PRW
i
_PRT �PICM�R05�R05[�7RP07_ADR ��RPA7 �PA7��  *_INI
pLTR7LTRNpPML7LMSLpPNL7LNSLpOBF7OBFN[�XCS �[�PXCS VDID @&L0SE LDIS   LASX
2ABPX PDCX PDSX  ( PSPX O D3HT N HPEXPMEX 0 L23EL23R �
LEDM[�PXCS@ @n HPSXPMSXLTRV J _DSM_T_0 ��
��S5zM���M�p� _T_0��T_0 OPTS
 �PTS FUN0�PTS
FUN4�PTS
FUN6�PTS
FUN8�PTS
	FUN9��i
pFUN0�LTREpFUN6�OBFFpFUN4��CR1��i
pFUN8pFUN9�PTS���T_0
��i
�OBFN�
  ��
 ���T_0
�
�i
� LTRN��LMSL �NSL ��CHSSPTHpFLMSLpFLNSL���CHSSPTLpLMSLpLNSLp{zLMSL


 �TRV p{LMSL�LTRV p{zLNSL


 �TRV
 p{LNSL�LTRV
 �TRV�����T_0
��CR1��i
����T_0
	��CR1��i
�P��� [�PXSX_ADR _PRW �PRW
i
-HPME�PMSXp
��`pPMSX�PMSXv`�p `�XSX
_PRW �PRW
i
_PRT �PICM�R06�R06[�7RP08_ADR ��RPA8 �PA8��  *_INI
pLTR8LTRNpPML8LMSLpPNL8LNSLpOBF8OBFN[�XCS �[�PXCS VDID @&L0SE LDIS   LASX
2ABPX PDCX PDSX  ( PSPX O D3HT N HPEXPMEX 0 L23EL23R �
LEDM[�PXCS@ @n HPSXPMSXLTRV J _DSM_T_0 ��
��S5zM���M�p� _T_0��T_0 OPTS
 �PTS FUN0�PTS
FUN4�PTS
FUN6�PTS
FUN8�PTS
	FUN9��i
pFUN0�LTREpFUN6�OBFFpFUN4��CR1��i
pFUN8pFUN9�PTS���T_0
��i
�OBFN�
  ��
 ���T_0
�
�i
� LTRN��LMSL �NSL ��CHSSPTHpFLMSLpFLNSL���CHSSPTLpLMSLpLNSLp{zLMSL


 �TRV p{LMSL�LTRV p{zLNSL


 �TRV
 p{LNSL�LTRV
 �TRV�����T_0
��CR1��i
����T_0
	��CR1��i
�P��� [�PXSX_ADR _PRW �PRW
i
-HPME�PMSXp
��`pPMSX�PMSXv`�p `�XSX
_PRW �PRW
i
_PRT �PICM�R07�R07[�7RP09_ADR ��RPA9 �PA9��  *_INI
pLTR9LTRNpPML9LMSLpPNL9LNSLpOBF9OBFN[�XCS �[�PXCS VDID @&L0SE LDIS   LASX
2ABPX PDCX PDSX  ( PSPX O D3HT N HPEXPMEX 0 L23EL23R �
LEDM[�PXCS@ @n HPSXPMSXLTRV J _DSM_T_0 ��
��S5zM���M�p� _T_0��T_0 OPTS
 �PTS FUN0�PTS
FUN4�PTS
FUN6�PTS
FUN8�PTS
	FUN9��i
pFUN0�LTREpFUN6�OBFFpFUN4��CR1��i
pFUN8pFUN9�PTS���T_0
��i
�OBFN�
  ��
 ���T_0
�
�i
� LTRN��LMSL �NSL ��CHSSPTHpFLMSLpFLNSL���CHSSPTLpLMSLpLNSLp{zLMSL


 �TRV p{LMSL�LTRV p{zLNSL


 �TRV
 p{LNSL�LTRV
 �TRV�����T_0
��CR1��i
����T_0
	��CR1��i
�P��� [�PXSX_ADR _PRW �PRW
i
-HPME�PMSXp
��`pPMSX�PMSXv`�p `�XSX
_PRW �PRW
i
_PRT �PICM�R04�R04[�7RP10_ADR ��RPAA �PAA��  *_INI
pLTRALTRNpPMLALMSLpPNLALNSLpOBFAOBFN[�XCS �[�PXCS VDID @&L0SE LDIS   LASX
2ABPX PDCX PDSX  ( PSPX O D3HT N HPEXPMEX 0 L23EL23R �
LEDM[�PXCS@ @n HPSXPMSXLTRV J _DSM_T_0 ��
��S5zM���M�p� _T_0��T_0 OPTS
 �PTS FUN0�PTS
FUN4�PTS
FUN6�PTS
FUN8�PTS
	FUN9��i
pFUN0�LTREpFUN6�OBFFpFUN4��CR1��i
pFUN8pFUN9�PTS���T_0
��i
�OBFN�
  ��
 ���T_0
�
�i
� LTRN��LMSL �NSL ��CHSSPTHpFLMSLpFLNSL���CHSSPTLpLMSLpLNSLp{zLMSL


 �TRV p{LMSL�LTRV p{zLNSL


 �TRV
 p{LNSL�LTRV
 �TRV�����T_0
��CR1��i
����T_0
	��CR1��i
�P��� [�PXSX_ADR _PRW �PRW
i
-HPME�PMSXp
��`pPMSX�PMSXv`�p `�XSX
_PRW �PRW
i
_PRT �PICM�R05�R05[�7RP11_ADR ��RPAB �PAB��  *_INI
pLTRBLTRNpPMLBLMSLpPNLBLNSLpOBFBOBFN[�XCS �[�PXCS VDID @&L0SE LDIS   LASX
2ABPX PDCX PDSX  ( PSPX O D3HT N HPEXPMEX 0 L23EL23R �
LEDM[�PXCS@ @n HPSXPMSXLTRV J _DSM_T_0 ��
��S5zM���M�p� _T_0��T_0 OPTS
 �PTS FUN0�PTS
FUN4�PTS
FUN6�PTS
FUN8�PTS
	FUN9��i
pFUN0�LTREpFUN6�OBFFpFUN4��CR1��i
pFUN8pFUN9�PTS���T_0
��i
�OBFN�
  ��
 ���T_0
�
�i
� LTRN��LMSL �NSL ��CHSSPTHpFLMSLpFLNSL���CHSSPTLpLMSLpLNSLp{zLMSL


 �TRV p{LMSL�LTRV p{zLNSL


 �TRV
 p{LNSL�LTRV
 �TRV�����T_0
��CR1��i
����T_0
	��CR1��i
�P��� [�PXSX_ADR _PRW �PRW
i
-HPME�PMSXp
��`pPMSX�PMSXv`�p `�XSX
_PRW �PRW
i
_PRT �PICM�R06�R06[�7RP12_ADR ��RPAC �PAC��  *_INI
pLTRCLTRNpPMLCLMSLpPNLCLNSLpOBFCOBFN[�XCS �[�PXCS VDID @&L0SE LDIS   LASX
2ABPX PDCX PDSX  ( PSPX O D3HT N HPEXPMEX 0 L23EL23R �
LEDM[�PXCS@ @n HPSXPMSXLTRV J _DSM_T_0 ��
��S5zM���M�p� _T_0��T_0 OPTS
 �PTS FUN0�PTS
FUN4�PTS
FUN6�PTS
FUN8�PTS
	FUN9��i
pFUN0�LTREpFUN6�OBFFpFUN4��CR1��i
pFUN8pFUN9�PTS���T_0
��i
�OBFN�
  ��
 ���T_0
�
�i
� LTRN��LMSL �NSL ��CHSSPTHpFLMSLpFLNSL���CHSSPTLpLMSLpLNSLp{zLMSL


 �TRV p{LMSL�LTRV p{zLNSL


 �TRV
 p{LNSL�LTRV
 �TRV�����T_0
��CR1��i
����T_0
	��CR1��i
�P��� [�PXSX_ADR _PRW �PRW
i
-HPME�PMSXp
��`pPMSX�PMSXv`�p `�XSX
_PRW �PRW
i
_PRT �PICM�R07�R07[�7RP13_ADR ��RPAD �PAD��  *_INI
pLTRDLTRNpPMLDLMSLpPNLDLNSLpOBFDOBFN[�XCS �[�PXCS VDID @&L0SE LDIS   LASX
2ABPX PDCX PDSX  ( PSPX O D3HT N HPEXPMEX 0 L23EL23R �
LEDM[�PXCS@ @n HPSXPMSXLTRV J _DSM_T_0 ��
��S5zM���M�p� _T_0��T_0 OPTS
 �PTS FUN0�PTS
FUN4�PTS
FUN6�PTS
FUN8�PTS
	FUN9��i
pFUN0�LTREpFUN6�OBFFpFUN4��CR1��i
pFUN8pFUN9�PTS���T_0
��i
�OBFN�
  ��
 ���T_0
�
�i
� LTRN��LMSL �NSL ��CHSSPTHpFLMSLpFLNSL���CHSSPTLpLMSLpLNSLp{zLMSL


 �TRV p{LMSL�LTRV p{zLNSL


 �TRV
 p{LNSL�LTRV
 �TRV�����T_0
��CR1��i
����T_0
	��CR1��i
�P��� [�PXSX_ADR _PRW �PRW
i
-HPME�PMSXp
��`pPMSX�PMSXv`�p `�XSX
_PRW �PRW
i
_PRT �PICM�R04�R04[�7RP14_ADR ��RPAE �PAE��  *_INI
pLTRELTRNpPMLELMSLpPNLELNSLpOBFEOBFN[�XCS �[�PXCS VDID @&L0SE LDIS   LASX
2ABPX PDCX PDSX  ( PSPX O D3HT N HPEXPMEX 0 L23EL23R �
LEDM[�PXCS@ @n HPSXPMSXLTRV J _DSM_T_0 ��
��S5zM���M�p� _T_0��T_0 OPTS
 �PTS FUN0�PTS
FUN4�PTS
FUN6�PTS
FUN8�PTS
	FUN9��i
pFUN0�LTREpFUN6�OBFFpFUN4��CR1��i
pFUN8pFUN9�PTS���T_0
��i
�OBFN�
  ��
 ���T_0
�
�i
� LTRN��LMSL �NSL ��CHSSPTHpFLMSLpFLNSL���CHSSPTLpLMSLpLNSLp{zLMSL


 �TRV p{LMSL�LTRV p{zLNSL


 �TRV
 p{LNSL�LTRV
 �TRV�����T_0
��CR1��i
����T_0
	��CR1��i
�P��� [�PXSX_ADR _PRW �PRW
i
-HPME�PMSXp
��`pPMSX�PMSXv`�p `�XSX
_PRW �PRW
i
_PRT �PICM�R05�R05[�7RP15_ADR ��RPAF �PAF��  *_INI
pLTRFLTRNpPMLFLMSLpPNLFLNSLpOBFFOBFN[�XCS �[�PXCS VDID @&L0SE LDIS   LASX
2ABPX PDCX PDSX  ( PSPX O D3HT N HPEXPMEX 0 L23EL23R �
LEDM[�PXCS@ @n HPSXPMSXLTRV J _DSM_T_0 ��
��S5zM���M�p� _T_0��T_0 OPTS
 �PTS FUN0�PTS
FUN4�PTS
FUN6�PTS
FUN8�PTS
	FUN9��i
pFUN0�LTREpFUN6�OBFFpFUN4��CR1��i
pFUN8pFUN9�PTS���T_0
��i
�OBFN�
  ��
 ���T_0
�
�i
� LTRN��LMSL �NSL ��CHSSPTHpFLMSLpFLNSL���CHSSPTLpLMSLpLNSLp{zLMSL


 �TRV p{LMSL�LTRV p{zLNSL


 �TRV
 p{LNSL�LTRV
 �TRV�����T_0
��CR1��i
����T_0
	��CR1��i
�P��� [�PXSX_ADR _PRW �PRW
i
-HPME�PMSXp
��`pPMSX�PMSXv`�p `�XSX
_PRW �PRW
i
_PRT �PICM�R06�R06[�7RP16_ADR ��RPAG �PAG��  *_INI
pLTRGLTRNpPMLGLMSLpPNLGLNSLpOBFGOBFN[�XCS �[�PXCS VDID @&L0SE LDIS   LASX
2ABPX PDCX PDSX  ( PSPX O D3HT N HPEXPMEX 0 L23EL23R �
LEDM[�PXCS@ @n HPSXPMSXLTRV J _DSM_T_0 ��
��S5zM���M�p� _T_0��T_0 OPTS
 �PTS FUN0�PTS
FUN4�PTS
FUN6�PTS
FUN8�PTS
	FUN9��i
pFUN0�LTREpFUN6�OBFFpFUN4��CR1��i
pFUN8pFUN9�PTS���T_0
��i
�OBFN�
  ��
 ���T_0
�
�i
� LTRN��LMSL �NSL ��CHSSPTHpFLMSLpFLNSL���CHSSPTLpLMSLpLNSLp{zLMSL


 �TRV p{LMSL�LTRV p{zLNSL


 �TRV
 p{LNSL�LTRV
 �TRV�����T_0
��CR1��i
����T_0
	��CR1��i
�P��� [�PXSX_ADR _PRW �PRW
i
-HPME�PMSXp
��`pPMSX�PMSXv`�p `�XSX
_PRW �PRW
i
_PRT �PICM�R07�R07[�7RP17_ADR ��RPAH �PAH��  *_INI
pLTRHLTRNpPMLHLMSLpPNLHLNSLpOBFHOBFN[�XCS �[�PXCS VDID @&L0SE LDIS   LASX
2ABPX PDCX PDSX  ( PSPX O D3HT N HPEXPMEX 0 L23EL23R �
LEDM[�PXCS@ @n HPSXPMSXLTRV J _DSM_T_0 ��
��S5zM���M�p� _T_0��T_0 OPTS
 �PTS FUN0�PTS
FUN4�PTS
FUN6�PTS
FUN8�PTS
	FUN9��i
pFUN0�LTREpFUN6�OBFFpFUN4��CR1��i
pFUN8pFUN9�PTS���T_0
��i
�OBFN�
  ��
 ���T_0
�
�i
� LTRN��LMSL �NSL ��CHSSPTHpFLMSLpFLNSL���CHSSPTLpLMSLpLNSLp{zLMSL


 �TRV p{LMSL�LTRV p{zLNSL


 �TRV
 p{LNSL�LTRV
 �TRV�����T_0
��CR1��i
����T_0
	��CR1��i
�P��� [�PXSX_ADR _PRW �PRW
i
-HPME�PMSXp
��`pPMSX�PMSXv`�p `�XSX
_PRW �PRW
i
_PRT �PICM�R04�R04[�7RP18_ADR ��RPAI �PAI��  *_INI
pLTRILTRNpPMLILMSLpPNLILNSLpOBFIOBFN[�XCS �[�PXCS VDID @&L0SE LDIS   LASX
2ABPX PDCX PDSX  ( PSPX O D3HT N HPEXPMEX 0 L23EL23R �
LEDM[�PXCS@ @n HPSXPMSXLTRV J _DSM_T_0 ��
��S5zM���M�p� _T_0��T_0 OPTS
 �PTS FUN0�PTS
FUN4�PTS
FUN6�PTS
FUN8�PTS
	FUN9��i
pFUN0�LTREpFUN6�OBFFpFUN4��CR1��i
pFUN8pFUN9�PTS���T_0
��i
�OBFN�
  ��
 ���T_0
�
�i
� LTRN��LMSL �NSL ��CHSSPTHpFLMSLpFLNSL���CHSSPTLpLMSLpLNSLp{zLMSL


 �TRV p{LMSL�LTRV p{zLNSL


 �TRV
 p{LNSL�LTRV
 �TRV�����T_0
��CR1��i
����T_0
	��CR1��i
�P��� [�PXSX_ADR _PRW �PRW
i
-HPME�PMSXp
��`pPMSX�PMSXv`�p `�XSX
_PRW �PRW
i
_PRT �PICM�R05�R05[�7RP19_ADR ��RPAJ �PAJ��  *_INI
pLTRJLTRNpPMLJLMSLpPNLJLNSLpOBFJOBFN[�XCS �[�PXCS VDID @&L0SE LDIS   LASX
2ABPX PDCX PDSX  ( PSPX O D3HT N HPEXPMEX 0 L23EL23R �
LEDM[�PXCS@ @n HPSXPMSXLTRV J _DSM_T_0 ��
��S5zM���M�p� _T_0��T_0 OPTS
 �PTS FUN0�PTS
FUN4�PTS
FUN6�PTS
FUN8�PTS
	FUN9��i
pFUN0�LTREpFUN6�OBFFpFUN4��CR1��i
pFUN8pFUN9�PTS���T_0
��i
�OBFN�
  ��
 ���T_0
�
�i
� LTRN��LMSL �NSL ��CHSSPTHpFLMSLpFLNSL���CHSSPTLpLMSLpLNSLp{zLMSL


 �TRV p{LMSL�LTRV p{zLNSL


 �TRV
 p{LNSL�LTRV
 �TRV�����T_0
��CR1��i
����T_0
	��CR1��i
�P��� [�PXSX_ADR _PRW �PRW
i
-HPME�PMSXp
��`pPMSX�PMSXv`�p `�XSX
_PRW �PRW
i
_PRT �PICM�R06�R06[�7RP20_ADR ��RPAK �PAK��  *_INI
pLTRKLTRNpPMLKLMSLpPNLKLNSLpOBFKOBFN[�XCS �[�PXCS VDID @&L0SE LDIS   LASX
2ABPX PDCX PDSX  ( PSPX O D3HT N HPEXPMEX 0 L23EL23R �
LEDM[�PXCS@ @n HPSXPMSXLTRV J _DSM_T_0 ��
��S5zM���M�p� _T_0��T_0 OPTS
 �PTS FUN0�PTS
FUN4�PTS
FUN6�PTS
FUN8�PTS
	FUN9��i
pFUN0�LTREpFUN6�OBFFpFUN4��CR1��i
pFUN8pFUN9�PTS���T_0
��i
�OBFN�
  ��
 ���T_0
�
�i
� LTRN��LMSL �NSL ��CHSSPTHpFLMSLpFLNSL���CHSSPTLpLMSLpLNSLp{zLMSL


 �TRV p{LMSL�LTRV p{zLNSL


 �TRV
 p{LNSL�LTRV
 �TRV�����T_0
��CR1��i
����T_0
	��CR1��i
�P��� [�PXSX_ADR _PRW �PRW
i
-HPME�PMSXp
��`pPMSX�PMSXv`�p `�XSX
_PRW �PRW
i
_PRT �PICM�R07�R07[��T0_ADR  9_DSM�PCICh�CIDhijk�[\/_SB_PCI0SAT0SDSM
�DSMhijk�[�PRT0_ADR�PRT1_ADR�[�PRT2_ADR�[�PRT3_ADR�[�PRT4_ADR�[�PRT5_ADR�KRDCA_T_0
[�PAL rGPCBr � i
[�RPALRPCD [�PAC rGPCB�
[�EPACCAIR CADR [�CRG rGPCB�
[�NCRGCRGC ��
��phCRGC�p� _T_0��T_0 �PCD���T_0
piCAIR�ADR���T_0{jRPCD`}k``p`RPCD���T_0
piCAIR{jCADR`}k``p`CADR���RPD0 RDCAh
�� RPD3 RDCAh
��
[�BNVM1_ADR�PRBI PRBD PCMD NCRN NITV NPMV NPCV NL1V ND2V ND1V NLRV
NLDV NEAV NEBV NECV NRAV NMBV NMVV NPBV NPVV EPD0RDCANCRNrNPMV
 �
EPD3RDCANCRNrNPMV
 �

J CNRS��ITV �RDCANCRN

RDCANCRN

RDCANCRN

RDCANCRN

RDCANCRN

RDCANCRN
$
RDCANCRN
�PCMD
RDCANCRNPRBI PRBD
��NL1V RDCANCRNrNL1V
  �D2V
RDCANCRNrNL1V

{ND1V�
RDCANCRNrNL1V
 �ND1V
��NLRV RDCANCRNrNLRV
 �NLDV
RDCANCRNrNPCV
 ��EAV�RDCANCRNrNPCV
( �NECV
RDCANCRNrNPCV
 �EBV
RDCANCRN
h�NRAV��NEAV
@
@RDCANCRN
P����RDCANCRN
R  [!

RDCANCRNrNPCV
 �{NEAV

��NMVV RDCANCRNNMBV NMVV
��NPVV RDCANCRNNPBV NPVV
G_PS3��ITV �pRDCANCRN

PCMD��ITVp
$PRBIpRDCANCRN
$
PRBD���ITV
p
PRBIpRDCANCRN

PRBDEPD3RPD3NCRN?_PS0��ITV �RPD0NCRNEPD0pRDCANCRNrNPMV

`��`
 CNRSM _INI
pNIT1NITVpNPM1NPMVpNPC1NPCVpNL11NL1VpND21ND2VpND11ND1VpNLR1NLRVpNLD1NLDVpNEA1NEAVpNEB1NEBVpNEC1NECVpNRA1NRAVpNMB1NMBVpNMV1NMVVpNPB1NPBVpNPV1NPVVp
NCRN[�BNVM2_ADR�PRBI PRBD PCMD NCRN NITV NPMV NPCV NL1V ND2V ND1V
NLRV NLDV NEAV NEBV NECV NRAV NMBV NMVV NPBV NPVV EPD0RDCANCRNrNPMV
 �
EPD3RDCANCRNrNPMV
 �

J CNRS��ITV �RDCANCRN

RDCANCRN

RDCANCRN

RDCANCRN

RDCANCRN

RDCANCRN
$
RDCANCRN
�PCMD
RDCANCRNPRBI PRBD
��NL1V RDCANCRNrNL1V
  �D2V
RDCANCRNrNL1V

{ND1V�
RDCANCRNrNL1V
 �ND1V
��NLRV RDCANCRNrNLRV
 �NLDV
RDCANCRNrNPCV
 ��EAV�RDCANCRNrNPCV
( �NECV
RDCANCRNrNPCV
 �EBV
RDCANCRN
h�NRAV��NEAV
@
@RDCANCRN
P����RDCANCRN
R  [!

RDCANCRNrNPCV
 �{NEAV

��NMVV RDCANCRNNMBV NMVV
��NPVV RDCANCRNNPBV NPVV
G_PS3��ITV �pRDCANCRN

PCMD��ITVp
$PRBIpRDCANCRN
$
PRBD���ITV
p
PRBIpRDCANCRN

PRBDEPD3RPD3NCRN?_PS0��ITV �RPD0NCRNEPD0pRDCANCRNrNPMV

`��`
 CNRSM _INI
pNIT2NITVpNPM2NPMVpNPC2NPCVpNL12NL1VpND22ND2VpND12ND1VpNLR2NLRVpNLD2NLDVpNEA2NEAVpNEB2NEBVpNEC2NECVpNRA2NRAVpNMB2NMBVpNMV2NMVVpNPB2NPBVpNPV2NPVVpNCRN[�BNVM3_ADR�PRBI
PRBD PCMD NCRN NITV NPMV NPCV NL1V ND2V ND1V NLRV NLDV NEAV NEBV
NECV NRAV NMBV NMVV NPBV NPVV EPD0RDCANCRNrNPMV
 �
EPD3RDCANCRNrNPMV
 �

J CNRS��ITV �RDCANCRN

RDCANCRN

RDCANCRN

RDCANCRN

RDCANCRN

RDCANCRN
$
RDCANCRN
�PCMD
RDCANCRNPRBI PRBD
��NL1V RDCANCRNrNL1V
  �D2V
RDCANCRNrNL1V

{ND1V�
RDCANCRNrNL1V
 �ND1V
��NLRV RDCANCRNrNLRV
 �NLDV
RDCANCRNrNPCV
 ��EAV�RDCANCRNrNPCV
( �NECV
RDCANCRNrNPCV
 �EBV
RDCANCRN
h�NRAV��NEAV
@
@RDCANCRN
P����RDCANCRN
R  [!

RDCANCRNrNPCV
 �{NEAV

��NMVV RDCANCRNNMBV NMVV
��NPVV RDCANCRNNPBV NPVV
G_PS3��ITV �pRDCANCRN

PCMD��ITVp
$PRBIpRDCANCRN
$
PRBD���ITV
p
PRBIpRDCANCRN

PRBDEPD3RPD3NCRN?_PS0��ITV �RPD0NCRNEPD0pRDCANCRNrNPMV

`��`
 CNRSN _INI
pNIT3NITVpNPM3NPMVpNPC3NPCVpNL13NL1VpND23ND2VpND13ND1VpNLR3NLRVpNLD3NLDVpNEA3NEAVpNEB3NEBVpNEC3NECVpNRA3NRAVpNMB3NMBVpNMV3NMVVpNPB3NPBVpNPV3NPVVp
NCRN[�CIO2_STA ��IOE���_HIDINT343E ?_CRS CBUF
�  �  @� y �BUF
CIOVpCIOICIOV�BUF[�TERM_HIDINT343D _UID?_CRS RBUF
�  �� �  y �BUF
IRQNpTIRQIRQN�BUF_STA ��AEN ���IRQ ��@._SB_PCI02LPD3 [�CB1 rh
�
[�ICB1TEMP }TEMP
TEMPpTEMP`&LHRV [�CB1 rh

[�ICB1HRV_�RV_5LPD0 [�CB1 rh
�
[�ICB1TEMP {TEMP�TEMPpTEMP`*GETD [�CB1 rh
�
[�ICB1TEMP �TEMP
 FLCRSRBUF
�   �  y �BUF
BVAL�BUF
BLEN�BUF
IRQNpiBVALpjIRQN��
p
BLEN�BUF!LSTA ��h �
���SYS���GIRQ �
�
` C,._SB_PCI0[�SIRC_HIDA�_STA
_UID
LADDBBUFF
�   y �UFF
ADDR�UFF
LENGp
y `����
�
pjADDR�BUFF`��
piADDR�BUFF`��
pr
i ADDRp�NG�BUFF`�O_CRSp
y
`�ADDBSMD0SB00SB10`�ADDBSMD1SB01SB11`�ADDBSMD2SB02SB12`�ADDBSMD3SB03SB13`�ADDBSMD4SB04SB14`�ADDBSMD5SB05SB15`�ADDBSMD6SB06SB16`�ADDBSMD7SB07SB17`�ADDBSMD8SB08SB18`�ADDBSMD9SB09SB19`�ADDBSMDASB0ASB1A`��^.GPI0_STA
�^^.GPI0_CRS`�[�GPI0%_HID ��CHVSPTH�INT345D �INT344B LINK\_SB.PCI0.GPI0 I
_CRS RBUF2
/�   �   �   �  y �BUF
COM0�BUF
COM1�BUF
COM3�BUF
)IRQNprSBRG � COM0prSBRG � COM1prSBRG � COM3pSGIRIRQN�BUF_STA ��BRG ���PEN
��&._SB_PCI0[�I2C0LINK\_SB.PCI0.I2C0 ��SMD0
C/_SB_PCI0I2C0_HIDINT3442 _HRV �HRVSB10_CRS �CRSSMD0SB00SIR0_PSC
GETDSB10_PS0 LPD0SB10_PS3 LPD3SB10_STA �STASMD0��MD0
2/_SB_PCI0I2C0_ADR 
_DSM�PCICh�CIDhijk�&._SB_PCI0[�I2C1LINK\_SB.PCI0.I2C1 ��SMD1
C/_SB_PCI0I2C1_HIDINT3443 _HRV �HRVSB11_CRS �CRSSMD1SB01SIR1_PSC
GETDSB11_PS0 LPD0SB11_PS3 LPD3SB11_STA �STASMD1��MD1
2/_SB_PCI0I2C1_ADR 
_DSM�PCICh�CIDhijk�&._SB_PCI0[�I2C2LINK\_SB.PCI0.I2C2 ��SMD2
C/_SB_PCI0I2C2_HIDINT3444 _HRV �HRVSB12_CRS �CRSSMD2SB02SIR2_PSC
GETDSB12_PS0 LPD0SB12_PS3 LPD3SB12_STA �STASMD2��MD2
2/_SB_PCI0I2C2_ADR 
_DSM�PCICh�CIDhijk�&._SB_PCI0[�I2C3LINK\_SB.PCI0.I2C3 ��SMD3
C/_SB_PCI0I2C3_HIDINT3445 _HRV �HRVSB13_CRS �CRSSMD3SB03SIR3_PSC
GETDSB13_PS0 LPD0SB13_PS3 LPD3SB13_STA �STASMD3��MD3
2/_SB_PCI0I2C3_ADR 
_DSM�PCICh�CIDhijk�&._SB_PCI0[�I2C4LINK\_SB.PCI0.I2C4 ��SMD4
C/_SB_PCI0I2C4_HIDINT3446 _HRV �HRVSB14_CRS �CRSSMD4SB04SIR4_PSC
GETDSB14_PS0 LPD0SB14_PS3 LPD3SB14_STA �STASMD4��MD4
2/_SB_PCI0I2C4_ADR 
_DSM�PCICh�CIDhijk�&._SB_PCI0[�I2C5LINK\_SB.PCI0.I2C5 ��SMD5
C/_SB_PCI0I2C5_HIDINT3447 _HRV �HRVSB15_CRS �CRSSMD5SB05SIR5_PSC
GETDSB15_PS0 LPD0SB15_PS3 LPD3SB15_STA �STASMD5��MD5
2/_SB_PCI0I2C5_ADR  _DSM�PCICh�CIDhijk�._SB_PCI0[�SPI0��SMD6
C/_SB_PCI0SPI0_HIDINT3440 _HRV �HRVSB16_CRS �CRSSMD6SB06SIR6_PSC
GETDSB16_PS0 LPD0SB16_PS3 LPD3SB16_STA �STASMD6��MD6
2/_SB_PCI0SPI0_ADR  _DSM�PCICh�CIDhijk�._SB_PCI0[�SPI1��SMD7
C/_SB_PCI0SPI1_HIDINT3441 _HRV �HRVSB17_CRS �CRSSMD7SB07SIR7_PSC
GETDSB17_PS0 LPD0SB17_PS3 LPD3SB17_STA �STASMD7��MD7
2/_SB_PCI0SPI1_ADR  _DSM�PCICh�CIDhijk�._SB_PCI0[�UA00��SMD8
D/_SB_PCI0UA00"_HID ��SMD9
�INT3448 ��A�_UIDSerialIoUart0 _DDNSerialIoUart0 _HRV �HRVSB18_CRS
�CRSSMD8SB08SIR8_PSC GETDSB18_PS0 ��SMD8
LPD0SB18_PS3 ��SMD8
LPD3SB18_STA �STASMD8��MD8
2/_SB_PCI0UA00_ADR  _DSM�PCICh�CIDhijk�._SB_PCI0[�UA01��SMD9
D/_SB_PCI0UA01"_HID ��SMD9
�INT3449 ��A�_UIDSerialIoUart1 _DDNSerialIoUart1 _HRV �HRVSB19_CRS
�CRSSMD9SB09SIR9_PSC GETDSB19_PS0 ��SMD9
LPD0SB19_PS3 ��SMD9
LPD3SB19_STA �STASMD9��MD9
2/_SB_PCI0UA01_ADR  _DSM�PCICh�CIDhijk�._SB_PCI0[�UA02��SMDA
D/_SB_PCI0UA02"_HID ��SMDA
�INT344A ��A�_UIDSerialIoUart2 _DDNSerialIoUart2 _HRV �HRVSB1A_CRS
�CRSSMDASB0ASIRA_PSC GETDSB1A_PS0 ��SMDA
LPD0SB1A_PS3 ��SMDA
LPD3SB1A_STA �STASMDA��MDA
2/_SB_PCI0UA02_ADR  _DSM�PCICh�CIDhijk�D ._SB_PCI0HIDG
�gBUE��=��TP7G
��Q���K)HIDD��HIDG�� ������� ,TP7D��TP7G�� ������lm �
D?/_SB_PCI0I2C0[�$TPD0HID2 SBFB&
#�    � \_SB.PCI0.I2C0 y SBFI
�  y SBFG-
*�      ( \_SB.PCI0.GPI0 y �BFB
BADR�BFB
SPED�BFG
INT1�BFI
INT2J_INI ��SYS�SRXOGPDIpGNUMGPDIINT1pINUMGPDIINT2��DM0
SHPOGPDI��DS0pSYNA2393 _HIDp
 HID2���DS0
p06CB2846 _HIDp
 HID2���DS0
pCUST0001 _HIDpTPDHHID2pTPDBBADR��PDS p� SPED��PDSp� SPED��PDS
p@B SPED�_HIDXXXX0000 _CIDPNP0C50 _S0W
9_DSM��HIDG�IDDhijkHID2��TP7G�P7DhijkSBFBSBFG� #_STA ��SDS0
�SDS0�DS0
��3_CRS ��SYS��BFI��DM0 �SBFBSBFG �SBFBSBFI [�HDAC_HIDINT0000 _CIDINT0000
_DDNIntel(R) Smart Sound Technology Audio Codec _UIDCADR @ _INI
��2SCpINT3439 _HIDpINT3439 _CIDp
CADR���2SC
pINT343A _HIDpINT343A _CIDp
CADR���2SC
pINT343B _HIDpINT343B _CIDp
4CADR�M_CRS SBFB&
#�    � \_SB.PCI0.I2C0 y SBFI
�  y �BFB
ADR_pCADRADR_�BFI
AINTpINUM AINT��ID_
 �BFB�SBFBSBFI _STA ��I2SC ��A8/_SB_PCI0I2C1[�/TPL1HID2 SBFB&
#�    � L \_SB.PCI0.I2C1 y SBFG-
*�      ( \_SB.PCI0.GPI0 y SBFI
�  y �BFB
BADR�BFB
SPED�BFI
INT2�BFG
INT1M_INI ��SYS�SRXOGPLIpGNUMGPLIINT1pINUMGPLIINT2��DM1
SHPOGPLI��DS1pATML3432 _HIDp HID2p
LBADRp� SPED���DS1
pATML2952 _HIDp HID2p
JBADRp� SPED���DS1
pELAN2097 _HIDpHID2p
BADRp� SPED���DS1
pNTRG0001 _HIDpHID2p
BADRp� SPED���DS1
pNTRG0002 _HIDpHID2p
dBADRp� SPED���DS1
pCUST0000 _HIDpTPLHHID2pTPLBBADR��PLS p� SPED��PLSp� SPED��PLS
p@B SPED�_HIDXXXX0000 _CIDPNP0C50 _S0W
9_DSM��HIDG�IDDhijkHID2��TP7G�P7DhijkSBFBSBFG� _STA ��SDS1 ��3_CRS
��SYS��BFI��DM1 �SBFBSBFG �SBFBSBFI [�IMP3_ADR _HIDIMPJ0003 _CIDIMPJ0003
_UID_STA ��ID_
 ��7_CRS SBUF&
#�    � n \_SB.PCI0.I2C1 y �BUFK;/_SB_PCI0SPI1[�:FPNTF_HID
��DS7�FPC1011 ��DS7
�FPC1020 ��DS7
�VFSI6101 ��DS7
�VFSI7500 ��DS7
�EGIS0300 ��DS7
�FPC1021 �FPNT_DIS _INI SHPOGFPISHPOGFPS_STA ��SDS7 ��M._CRS_T_0
BBUFB
N�    �� \_SB.PCI0.SPI1 �     (  \_SB.PCI0.GPI0 y IBUF
�  y GBUF-
*�      ( \_SB.PCI0.GPI0 y UBUF-
*�     ( \_SB.PCI0.GPI0 y �BUF
SPEX�BUF
PHAX�BUF
;SPIN�BUF
GPIN�BUF
IPIN�BUF
ILVL�BUF
ITRG[GBUF
9
GLVL�BUF
8GTRG�BUF
9SCSP�BUF
UPINpGNUMGFPSSPINpGNUMGFPIGPINpINUMGFPIIPINpGNUMGFPIUPIN��SDS7
�DS7
p ILVLpITRGp GLVLpGTRG��DS7
p ILVLpITRG�pSDS7_T_0��T_0p��SPEXp PHAX���T_0
p�- SPEXp PHAX���T_0
p z SPEXpPHAX���T_0
p z SPEXp PHAX���T_0
p $�EXp PHAX���T_0
p�- SPEXp PHAX���DS7�BUF��SDS7
�DM7 �BBUF�BUFGBUF ��SDS7
�SDM7 �BBUF�BUFIBUF ��DM7 �BBUFGBUF �BBUFIBUF K&/_SB_PCI0UA00[�%BTH05_HID
��DS8�INT33E1 ��DS8
�BCM2E40 �INT33E1 !_INI SHPOGBTISHPOGBTWSHPOGBTKN_CRS SBFGC

�"  5 
 � �_SB.PCI0.UA00 �     ( \_SB.PCI0.GPI0 �     ( \_SB.PCI0.GPI0 �  
    ( \_SB.PCI0.GPI0 y �BFG
�NT3�BFG
<WAK3�BFG
dKIL3pGNUMGBTIINT3pGNUMGBTWWAK3pGNUMGBTKKIL3SBFID
�"  5 
 � �_SB.PCI0.UA00 �     ( \_SB.PCI0.GPI0 �     ( \_SB.PCI0.GPI0 �  y
 �BFI
zINT4�BFI
<WAK4�BFI
dKIL4pINUMGBTIINT4pGNUMGBTWWAK4pGNUMGBTKKIL4��DM8 �BFG��BFI_STA ��SDS8 ��_S0W
B._SB_PCI0[�GNSS_HIDINT33A2 L _CRS BUF1*
'�  5 
 � @ @ �_SB.PCI0.UA01 y BUF2-
*�     ( \_SB.PCI0.GPI0 y �UF2
RPINpGNUMGGNRRPIN��NSC�BUF1BUF2 ��UF2_STA ��NSC
��Nm._SB_PCI0[�mGEXP_ADR_STA
SGEPCSERGEXNhij SGEDCSERGEXNhijGEPS
�SERGEXNhi
SGEICSERGEXNhij
;INVC p `��
��3DC `
W3DC ` ��3DC`
W3DC` r``PPR_
INR_ 
OUTR


CFGR


POLR



EXPA
"UCCHEND_ READ CACHCG   
    
    
    
 G   
    
    
    
 W3DCpk���ACHh i j R3DC����ACHh i j BWREG[�AR0 h[�BAR0ICON TAR_
@DATA HCNT LCNT @ ABRT J RBCK @CLR_ @
ENB_ ACTVTFNF RFNE LHOLD @ENSB O�ST_ pr[3P�ap
RST_p ENB_pRBCK`pCLR_`p  HOLDpHCNTp�LCNTprEXPAi TAR_p
eICONpENB_��ENSB��3a�pjDATAprEND_k DATA��ACTV ��3a�p ENB_��ENSB
��3a�W3DCijk��3DCij W3DCij
�KRREG��CCH��3DCij
�3DCij[�AR0 h[�BAR0ICON TAR_ @DATA HCNT LCNT @ ABRT J RBCK @CLR_ @
ENB_ ACTVTFNF RFNE LHOLD @ENSB O�ST_ pr[3P�ap
RST_p ENB_pRBCK`pCLR_`p  HOLDpHCNTp�LCNTprEXPAi TAR_p
eICONpENB_��ENSB��3a�pjDATAprEND_READ DATA��ACTV ��3a�pDATA`p ENB_��ENSB
��3a��,PS0_ [�AR1 h
��BAR1 @BD0D3p D0D3pD0D3`-PS3_ [�AR1 h
��BAR1 @BD0D3p
D0D3pD0D3`E CSERSB1X SB0X SMDX PINN REGN REGA OLDV NEWV RETV ��
��� pSB10SB1XpSB00SB0XpSMD0SMDX��pSB11SB1XpSB01SB0XpSMD1SMDX��
pSB12SB1XpSB02SB0XpSMD2SMDX��
pSB13SB1XpSB03SB0XpSMD3SMDX��
pSB14SB1XpSB04SB0XpSMD4SMDX��
pSB15SB1XpSB05SB0XpSMD5SMDX��
������
������
���SMDX
��� pOUTR`��pCFGR`��
pINR_`��
pPOLR`PS0_SB1XxjPPR_PINNREGNp�`REGN REGApRREGSB0XiREGAOLDV��
p{zOLDVPINN RETV�{OLDV�PINN NEWV}ykPINN
NEWVNEWV��NEWVOLDVWREGSB0XiREGANEWVPS3_SB1X�ETVPKG1 PKG_ ph�KG_
�KG_2PKG3PKG_ ph�KG_ pi�KG_ pj�KG_
 �KG_�USTPH/_SB_PCI0I2C1SSCN �KG3SSHISSLISSDIFMCN �KG3FMHIFMLIFMDIFPCN
�KG3FPHIFPLIFPDIM0D3 �KG1M0CIM1D3 �KG1M1CI//_SB_PCI0SPI1M0D3
�KG1M0CSM1D3 �KG1M1CS//_SB_PCI0UA01M0D3 �KG1M0CUM1D3
�KG1M1CU�)�CHVSPTLA)._SB_PCI0[�PEMC_ADR  [�CSR  [�SCSR @BPSTA @
PGENA_PS0p PGENPCRA
� ��
PCRO
� E �PSTA�PSTApPSTA`_PS3pPGEN}PSTA
PSTApPSTA`B
_DSM_T_0 �PCICh�CIDhijkADBGsEMH4= �MH4 ��
���F�)�a�� �pj_T_0��T_0 ��MH4�a�!���T_0
����T_0
��� �� [�CARD_ADR
_RMV �[�PSDC_ADR  [�CSR  [�SCSR @BPSTA @ PGEN>_PS0p PGENPCRA
� z�"
PCRO
� �{PSTA�PSTApPSTA`_PS3pPGEN}PSTA
PSTApPSTA`I_DSM_T_0 �PCICh�CIDhijk��
���F�)�a�� �pj_T_0��T_0 ����T_0
["
d� ���T_0
["
d� �� �� [�CARD_ADR
_RMV �2._SB_PCI0[�ISHD_ADR  _DSM�PCICh�CIDhijk2._SB_PCI0[�HECI_ADR 
_DSM�PCICh�CIDhijk�/_SB_PCI0LPCB[�EC0__HIDA� _UIDECAV [LFCM _GPE
pGGPE `�&_CRS BFFR
Gb b Gf f y �FFR _STA �[�RAM
�ERAMVCMD[�MMP  ���MERAM VDATVSTA
FANSBUSGBLEGBATFBNSMBTSTBBADAUTOFCHGABTLDBTLEDCCALSCCDMBCCSBBTSMBTCMLBTMCSBMSGSTHDMIHYBDSWSTEVNTDCRFCOLRSGCNODPOEODDODPKCMEXCMONSODDODFBEODSRTMPVTMPAFCCPINFSUPRGTMPQUITLS35
RMBTRSBTVTYP FUSLFUSHFWBT@ HECTP 0ESMC EMODBFUD
HEXSIEXSBEXNDSMPRSMSTSMADSMCMSMDA@BCNTSMAASAD0SAD1 KBLOUCHEKLCH
KLFSKLORUCHRUCERTPDV ECHG BMN0HBDN0@IBTLIBCLISS0IRTCISUPISC2IWAK
 VOUTTPADHKDB  OSTY ADPI
ADPTPMEWMODWLANWRTCWWLAWUSBWKEYWTPWKCHCRADPPLERNACMDBOVPLEAKAIRPACOFS3ENS3RSS4ENS4RSS5ENS5RS
OSTTOSSTTHRTTCOTMODE INITFAN1FAN2FAOKSKINSDTESPDNFNUMTLVL
THSWTPINTSTHTSCP PLVLCPUTCPTL ( PWDBDIGTCDLK 
LSTEPMEEPWBERNGEBTWE LCBVAOACS35FIFFSINS0ISBLISOV
ISRTWLANBLUEWEXTBEXTKILLWLOKEN3GEX3GKPIDCTYPCOREGATYBA1PBA2P
B1CHB2CH PBY1PBY2 SMB1SMB2 B1TYB1MDB1LW B1MF
B1STB1RCB1SNB1FVB1DVB1DCB1FCB1GSB1CTB1CRB1ACB1PCB1VLB1TMB1ATB1CCB1TCB1CIB1CUB1CAB1SMB1VCB1FAB1VAB1C1B1C2B1C3B1C4
(B1EXB1FLB1EPB1FI B1RE B1LLB1CEB1SEB1S5B1SRB1SC
B1TOB1BCB1CFB1CSB1SGB1SUB1OVB1OTB1TTB1SAB1SS B1SFB1WN B1DA B1CN
[�MDE
h
[�CMDEEC68   EC6C)WIBEp  `�`pEC6Ca��a
 �[!

v`�(WOBFp  `�`pEC6Ca��a �[!

v`�0WOBEp  `�`pEC6Ca��a pEC68b��[!

v`�FLCMD
LBUF
 ��IBE���OBE�phEC6C��IBE���� �i
�C68��IBE���OBF�pEC68`p a�`��OBF�pEC68�BUFa uav`�BUFKLRAM
��IBE���OBE�p
~EC6C��IBE�phEC68��IBE�piEC68��IBE���OBF��C68[�@BAT0_HIDA�
_UID_PCL_SB_PBIF8 ���
d LCFC BAT20101001 LiP LENOVO PBST� 0*;_STA ��CON��#LFCM
�pBA1P`['LFCM�{` ������@_BIF ��CON��#LFCM �pB1DC`w`

`p`�BIF pB1FC`w`

`p`�BIF
 pB1DV�BIF
 �B1FCpxwB1FC



 �BIF
 pxwB1FC


 �BIF
 pxwB1DC


d �BIF
 p �BIF
	 p �BIF

 p �BIF
 p �BIF
 BDNT
	 pBDN0BDNTp�DNT�BIF
	 pB1SN`SERN
 p
b�`x`

a`ra
0�ERNb vbpSERN�BIF

 DCH0

 DCH1LION DCH2LiP ��1TYpDCH1DCH0p�CH0�BIF
 �pDCH2DCH0p�CH0�BIF
 BMNT

 pBMN0BMNTp�MNT�BIF
 ['LFCM�BIFOBST OBAC OBPR OBRC OBPV E_BST_T_0 ��CON��#LFCM
�pB1ST`��B1ST`pB1ST`p�PBST a�p{`
 _T_0��T_0 p{a
�ST���T_0p}{a
�BST���T_0
p}
{a
�BST���T_0
p}
{a
�BST�B1ACOBAC��B1ACOBACpB1ACOBAC�{OBST ��OBAC p{�BAC
�BACpB1RCOBRCpB1FVOBPV���1RCOBRC�B1FVOBPVpB1RCOBRCpB1FVOBPVwOBRC

OBRCpxwOBACOBPV � OBPRpOBST�BST pOBPR�BST pOBRC�BST
 pOBPV�BST
 ['LFCM�BST@�/_SB_PCI0LPCBEC0_[��PC0_HIDVPC2004 _UID _VPC�VPCD  _STA
�?_CFG p_VPC`{`�`��EXT}`  `��EXT}`  `p`_VPC�VPC6VPCR ��#LFCM
���pVCMDVPCD�pVDATVPCD['LFCM�PCD-VPCW
��#LFCM ���piVCMD�piVDAT['LFCM�SVCR LHALS p `��#LFCM �}`
`��KBLO}`
 `}`
@`��UCHE}`
�}` `��KDB}` `}` `['LFCM�MSALS p� `��#LFCM ���
pKBLOpKLCH['LFCM���
	p KBLOpKLCH['LFCM���

pUCHEp
2SMIDp
�MIC['LFCM���
p UCHEp
3SMIDp
�MIC['LFCM���
p HKDBp
0SMIDp
�MIC['LFCM���
pHKDBp
1SMIDp
�MIC['LFCM�['LFCM�DGBMD p `��#LFCM ���CDMB}``��ECHG}`
`��BBAD}`
`��BTSM}`
 `��BLEG}`
���BATF}` `��BTSM}` `��BUSG}` `��ADPI{`�`��ADPI}` ���ADPI}`  `}` 
`}`  `}`  `��ESMC}` @ `['LFCM�VBST VBAC VBPR VBRC VBPV VBFC VBCT
GSMTF��#LFCM ��
� ��1FV ['LFCM���1AC ['LFCM��1FC`w`

`p`VBFCpB1RCawa

apaVBRC��BFCVBRCpB1FVVBPVpB1ACVBACt`a`pwVBACVBPV apw`�cpwc
< cpxca VBCT['LFCM�BCT�['LFCM���['LFCM��LFCM��BST QBAC QBPR QBRC QBPV
QBFC QBCT @SMTE��#LFCM ��� ��1FV ['LFCM���1AC ['LFCM��1RC`w`

`p`QBRCpB1FCawa

apaQBFC��BFCQBRCpB1FVQBPV��B1AC � pB1ACQBAC�pt�AC QBACpwQBACQBPV apw`�cpwc
< cpxca QBCT['LFCM�BCT�['LFCM���['LFCM��LFCM��SBMC��#LFCM ��� p
CDMBpEDCC['LFCM���pCDMB['LFCM���
pBTSM['LFCM���
p BTSM['LFCM���
pECHG['LFCM���
p ECHG['LFCM���
	pESMC['LFCM���
p ESMC['LFCM�['LFCM�8MHCFp
xP80Hph`��#LFCM �{`
 `z`
`p`RMBT["
['LFCM�AMHPF��#LFCM �BFWB
%�FWB FB0_�FWBFB1_�FWB
FB2_�FWB
FB3_[BFWB
  FB4_�FWB
$FB5_���
%��SMPR pSMSTFB1_�
phBFWBpFB2_SMADpFB3_SMCMpFB5_BCNTpFB0_`��` pFB4_SMDAp
SMSTpFB0_SMPRp��a["va��SMST
�SMPR �FB0_`��{` pSMDAFB4_pSMSTFB1_��a �SMST
� SMPRp
�B1_['LFCM�FWB['LFCMCMHIF��#LFCM �p
PP80H�� RETB

BUF1
pFWBTBUF1�UF1 FW0_�UF1FW1_�UF1
FW2_�UF1
FW3_�UF1
FW4_�UF1
FW5_�UF1
FW6_�UF1
FW7_pFUSL�ETB pFUSH�ETB pFW0_�ETB
 pFW1_�ETB
 pFW2_�ETB
 pFW3_�ETB
 pFW4_�ETB
 pFW5_�ETB
 pFW6_�ETB
 pFW7_�ETB
	 ['LFCM�ETB['LFCMA+GSBIBIFBG
S���������������������BIFB DCAP�IFB
FCAP�IFB
RCAP�IFB
ATTE�IFB
ATTF�IFB

BTVT�IFB
BTCT�IFB
BTMP�IFB
MDAT�IFB
FUDT�IFB
DVLT[BIFB
�PDCHE[BIFB 
@DNAM[BIFB@
`MNAM[BIFB�
�RNB�IFB
KBFW0��h ���CON��#LFCM �pB1DC`w`

`p`DCAPpB1FC`w`

`p`FCAPpB1RC`w`

`p`RCAPpSMTE ATTEpSMTF ATTFpB1FVBTVTpB1ACBTCTpB1AT`r``w`

`p`BTMPpB1DAMDAT��BFUD pBFUDFUDTpB1DVDVLTDCH0

 DCH1LION DCH2LiP ��1TYpDCH1DCH0pDCH0DCHE�pDCH2DCH0pDCH0DCHEBDNT
 pBDN0BDNTpBDNTDNAMBMNT
 pBMN0BMNTpBMNTMNAMBRN0
 p
ap
)b�apLRAM
b�RN0t
a ubvapBRN0BRNBpFWBTBFW0['LFCM�IFB��
�IFB�HODD SODD LGBIDGBUF&
 
 
 
 ��#LFCM �pB1CT��BUF p ��BUF BUF1
pFWBTBUF1�UF1 FW0_�UF1FW1_�UF1
FW2_�UF1
FW3_�UF1
FW4_�UF1
FW5_�UF1
FW6_�UF1
FW7_pFW0_��BUF
 pFW1_��BUF
  pFW2_��BUF

 pFW3_��BUF

 pFW4_��BUF

 pFW5_��BUF

 pFW6_��BUF

 pFW7_��BUF

 p ��BUF
 ['LFCM�BUFAPDT APPC phAPDT�)DBSL �!
���~
i
V
E
6
)





 6SBSL ��#LFCM �ph`��p
LCBV��
p
LCBV['LFCM�STHT �D\ [�FCN �� [�LFCNPS2VKBIDMCSZEDID@@LFCO@2[�MIO
�[�SMIOSMICSMIDBCL7
P
2




(
2
<
F
P
Z
dK_REG��h
�pECAVp `��SYS�`��SYS�p
`��SYS�p
`��SYS�p
`��SYS�p
`��OSYS�p
`��#LFCM �p`OSTYpECON��STE p ^^^.GFX0CLID��STEp
^^^.GFX0CLIDpLSTELIDSp
PLVL['LFCMCMFC�DIDBLTB






"
2
F
d?BSYC ��SYS�p `{^^^.GFX0CBLV
��`

���BLTB` �`p`LCBVL _Q11 p
P80H��SYS���CBV

p

LCBV{^^^.GFX0CBLV
��`�BLTBLCBV BSYC�^^.GFX0DD1F
�9�SYS����^^.GFX0CADL �^^^.GFX0CAL2 ��CBV vLCBV�PC0
�L _Q12 p
P80H��SYS���CBV

p LCBV{^^^.GFX0CBLV
��`�BLTBLCBV BSYC�^^.GFX0DD1F
�:�SYS����^^.GFX0CADL �^^^.GFX0CAL2 ��CBV

uLCBV�PC0
�1_Q15 p
P80H�S2M
pLIDS^^^.GFX0GLIDLIDS�ID0
�1_Q16 p
P80H�S2M
p LIDS^^^.GFX0GLIDLIDS�ID0
�_Q1C p
P80H5_Q1D p
P80H��#LFCM �pTLVL`['LFCMp`\._PR_CPPCPNOT"_Q25 p
%P80H�DP0
�BAT0
�BAT0
�*_Q37 [",p
7P80HpPWRS�DP0
�BAT0
�NOT*_Q38 [",p
8P80Hp PWRS�DP0
�BAT0
�NOT_Q32 p
2P80H�WRB
�_Q3E p
>P80H�S2M
>_Q3F p
?P80H�S2M
?_Q44 p
DP80H�PC0
�N_Q65 ��SYS���LAN SGOV  �SGOV ��LUE SGOV  �SGOV \ GPSF
DCPS DGST
�B_Q62 ��#LFCM ���ATY
pDCPS��DGST
�
bP80Hp
�GST�^^.PEG0PEGP
�"

��PSFp GPSF�^^.PEG0PEGP
�'LFCMB_Q63 ��#LFCM ���ATY
p DCPS��DGST
�
cP80Hp
�GST�^^.PEG0PEGP
�"

��PSF pGPSF�^^.PEG0PEGP
�'LFCMC_Q85 ��#LFCM ���ATY
pDCPS��DGST
�
�80Hp
�GST�^^.PEG0PEGP
�"

��PSFp GPSF�^^.PEG0PEGP
�
\._PR_CPPCPNOT['LFCMC_Q84 ��#LFCM ���ATY
pDCPS��DGST
�
�80Hp
�GST�^^.PEG0PEGP
�"

��PSFp GPSF�^^.PEG0PEGP
�

\._PR_CPPCPNOT['LFCMB_Q83 ��#LFCM ���ATY
pDCPS��DGST
�
�80Hp
�GST�^^.PEG0PEGP
�"

��PSFp GPSF�^^.PEG0PEGP
�\._PR_CPPCPNOT['LFCMB_Q82 ��#LFCM ���ATY
pDCPS��DGST
�
�80Hp
�GST�^^.PEG0PEGP
�"

��PSFp GPSF�^^.PEG0PEGP
�\._PR_CPPCPNOT['LFCMB_Q81 ��#LFCM ���ATY
p DCPS��DGST
�
�80Hp
�GST�^^.PEG0PEGP
�"

��PSF pGPSF�^^.PEG0PEGP
� \._PR_CPPCPNOT['LFCM@[\_SB_[�ADP0_HIDACPI0003 _STA ��CON��O_PSR
��#^^/PCI0LPCBEC0_LFCM ��^/PCI0LPCBEC0_ADPT['^^/PCI0LPCBEC0_LFCM_PCL
�_SB_[�LID0_HIDA�_STA ��CON��_LID �IDS[�PWRB_HIDA�_STA
��CON��[�LWMI4_HIDA�_UID
[MWMI _WDG+
(v7�����?<AD!�f�� �)BD ITEM< BAT0 BatMaker  BAT0 HwId 
BAT0 MfgDate EWQAD��#^^/PCI0LPCBEC0_LFCM �pPSAGh`p�ITEM` ap�a bp�a cp�a
 dpBATDbcesd, fsfeg['^^/PCI0LPCBEC0_LFCM�PSAG�FBATDSTRB

 BUFR
p^^/PCI0LPCBEC0_FWBTBUFR�UFR MID0�UFR
HID0�UFR
FIR0�UFR
DAT0�� �� p�ID0 STRB��p�ID0 STRB�
�
p^^/PCI0LPCBEC0_B1DA`DATB
	00000000 p
cp{`
 a�axa

barb
0�ATBc vcp
cpz{`�
 a�axa

barb
0�ATBc vcp
cprz{` � � a�axa

barb
0�ATBc vcpDATBSTRB�STRB�QBDJ'uFOMB e �DS }�т
B�!�P�A��!�p.@��"�������:
S�ND���Bh���[����%f(��`����"B��4OL����X�*���l���Ip�Z��9��H&m(�{Z'�<(��'(B�<
ϱx�L�#��G.�C万�?`��v�B���@ɀ�Va5��tvХ!Fo��
k��6��!↬E�5P��H�w�O����p��L@.
��2�z�@�8���]|�P�:`����3���TfO:M� �$���z����������� �$�yp<��G
~��]�q8g�*�\���� ��� ;$xG��'<>�����`WhӧF��(ӠV����{!�X
4���FWHD_HID%� _CRS
� �y [�HPET_HIDA�_UID BUF0
�  �  y _STA �HPTE��%_CRS�HPTE�UF0
HPT0pHPTBHPT0�UF0[�
IPIC_HIDA�_CRSA
� G$ $ G( ( G, , G0 0 G4 4 G8 8 G< <
G��G��G��G��G��G��G��G��G��" y
[�MATH_HIDA�_CRS
G�" y _STA ��CHVSPTH���[�
LDRC_HIDA�_UID
_CRSF
�.  . GN N Ga a Gc c Ge e Gg g Gp p G��G��G��G��
G�G�G�G  �Ny [�LDR2_HIDA�_UID
_CRS

G  � _STA ��CHVSPTH���[�RTC__HIDA� _CRS
Gp p " y [�TIMR_HIDA� _CRS
G@ @ GP P " y [�CWDT_HID%�_CIDA�BUF0

GTTy  _STA�_CRS�UF0[�KBS
`
[�PKBSPKBD   PKBC[�PS2K_HIDMSFT0001 _CIDA� _STA �_CRS
G` ` Gd d # y _PRS
1 K` Kd " 8y [�PS2MD_HID_T_1 _T_0 ��GIV �p�S2V _T_0��T_0�ETD063D
���T_0
�SYN2B5B ���T_0
�AUI1635 ��FFFFFFF �J�p�S2V _T_1��T_1�ETD0645 ���T_1
�SYN2B5D ���T_1
�AUI1637 ��FFFFFFF �@_CID_T_1 _T_0 ��GIV �p�S2V _T_0��T_0�
A��)��T_0
�A����T_0
�A������p�S2V _T_1��T_1�
A��)��T_1
�A����T_1
�A�����TPRDp
.P80H�^.EC0_ECTPTPWR p
/P80Hph^^.EC0_ECTP _STA �_CRS
# y _PRS
1 " 8y ECUP[EHLD N \ [� CHUB_HID%��_STA ��HEN��C_DSM_T_1 _T_0
��
��4J�Mv���� �p� _T_0��T_0 ����T_0�p�k _T_1��T_1 ����A_SB_[�TSS 
1�[�ITSSPARCPBRCPCRCPDRCPERCPFRCPGRCPHRC @�SCGE[MUTX [OSUM
[WFEVH2OEP8XE PFDP
��RTDPFDP
[�PRTDH2OD H2OP ��H2OE phH2OD[�RT0
�[�PRT0P80H GP8XH
�� p}{P80D �i P80D��p}{P80D� yi
 P80D��
p}{P80D� yi
 P80D��
p}{P80D� yi
 P80D��P8XE pP80DP80H[�PRT
�[�SPRTSSMP_PICphGPICphPICMLIDX G_PTSp P80DP8XH h��H2OP
Q��
H2OP
S��
H2OP
T��
H2OP
UADBGs_PTS= � ��BTS[&WFEV��
�[\._PR_DTSE ��._PR_DTSE�CNTTRAP

��BGS �[\/_SB_TPM_PTS_ \/_SB_TPM_PTS_h���
�
�
��FLV
\._SB_SGOV ��
p\/_SB_PCI0LPCBEC0_LSTELIDXLZ_WAK P8XH
�
�H2OP
��
H2OP
��
H2OP
��
H2OP
�BG_WAK \/_SB_PCI0GEXPINVC��0IDp\._SB_SCGE�NEXP�{OSCC
 \/_SB_PCI0NHPG�{OSCC
 \/_SB_PCI0NPME��
\/_SB_PCI0LPCBEC0__REG
��
��ACTT��CON�K�h
�
��CON��
p\/_SB_PCI0LPCBEC0_LSTELIDS��LIDXLIDS�IGDS��IDS p
�/_SB_PCI0GFX0CLID��IDSp �/_SB_PCI0GFX0CLID�._SB_LID0
�LIDSLIDX��
p\/_SB_PCI0LPCBEC0_LSTELIDS�IGDS��IDS p �/_SB_PCI0GFX0CLID��IDSp
�/_SB_PCI0GFX0CLID�._SB_LID0
�,�\/_SB_PCI0RP01VDID��/_SB_PCI0RP01 ��\/_SB_PCI0RP02VDID��/_SB_PCI0RP02
��\/_SB_PCI0RP03VDID��/_SB_PCI0RP03 ��\/_SB_PCI0RP04VDID��/_SB_PCI0RP04
��\/_SB_PCI0RP05VDID��/_SB_PCI0RP05 ��\/_SB_PCI0RP06VDID��/_SB_PCI0RP06
��\/_SB_PCI0RP07VDID���STS �/_SB_PCI0RP07 ��\/_SB_PCI0RP08VDID���STS
�/_SB_PCI0RP08 ��\/_SB_PCI0RP09VDID��/_SB_PCI0RP09
��\/_SB_PCI0RP10VDID��/_SB_PCI0RP10 ��\/_SB_PCI0RP11VDID��/_SB_PCI0RP11
��\/_SB_PCI0RP12VDID��/_SB_PCI0RP12 ��\/_SB_PCI0RP13VDID��/_SB_PCI0RP13
��\/_SB_PCI0RP14VDID��/_SB_PCI0RP14 ��\/_SB_PCI0RP15VDID��/_SB_PCI0RP15
��\/_SB_PCI0RP16VDID��/_SB_PCI0RP16 ��\/_SB_PCI0RP17VDID��/_SB_PCI0RP17
��\/_SB_PCI0RP18VDID��/_SB_PCI0RP18 ��\/_SB_PCI0RP19VDID��/_SB_PCI0RP19
��\/_SB_PCI0RP20VDID��/_SB_PCI0RP20 ��h
�
��BTS[$WFEV� GETBwh
`wi
a[j`aTBF3�BF3OPNOT��CNT�{PDC0
 �._PR_CPU0
�{PDC1
 �._PR_CPU1
�{PDC2
 �._PR_CPU2
�{PDC3
 �._PR_CPU3
�{PDC4
 �._PR_CPU4
�{PDC5
 �._PR_CPU5
�{PDC6
 �._PR_CPU6
�{PDC7
 �._PR_CPU7
��._PR_CPU0
�H�CNT��PDC0
 {PDC0
 �._PR_CPU0
��PDC1
 {PDC1
 �._PR_CPU1
��PDC2
 {PDC2
 �._PR_CPU2
��PDC3
 {PDC3
 �._PR_CPU3
��PDC4
 {PDC4
 �._PR_CPU4
��PDC5
 {PDC5
 �._PR_CPU5
��PDC6
 {PDC6
 �._PR_CPU6
��PDC7
 {PDC7
 �._PR_CPU7
��._PR_CPU0
��BAR r\/_SB_PCI0GMHB P  [�MBAR �PWRU L3PPL1PL1ECLP1CLMP PLEN PLSV
�CSEM GSPL1PPUU ��SEM�pCSEMpPPL1PLSVpPL1EPLENpCLP1CLMP��WRU pPPUU�yvPWRU
PPUUwPLVLPPUU`x`�apaPPL1pPL1EpCLP1'RPL1pPLSVPPL1pPLENPL1EpCLMPCLP1p
CSEMUAMS GLCK F#GUAM _T_0 ��SYS�rPWRV
�BGLoc 0 ADBG`[�CTC `
[�ACTC ACTD�p� _T_0��T_0 ��LCKp GLCKP8XH
�8XH
�DBGExit CS ��CNOADBGEC Notify p[#EHLD�� ��CLPpECUP['EHLD��CDBADBGEC Debug
��OSYS�p ACTD�PSCP�[\/_PR_CPU0_PPC p \._PR_CPPCPNOT�PLCSRPL1���T_0��LCK
pGLCKP8XH
�8XH ADBGEnter CS ��CNOADBGEC Notify ��CDBADBGEC Debug ��CLPp
ECUP��OSYS�pACTD�PSCP��\/_PR_CPU0_PSS [\/_PR_CPU0_PPC �{PDC0 
t�/_PR_CPU0TPSS\._PR_CPPC�t�/_PR_CPU0LPSS\._PR_CPPCPNOT�PLCSSPL1�����WRSUAMSP_CSGP_CS�[\/_SB_PCI0PAUDPUAM
\/_SB_PCI0PAUDPUAM��SYS��[\/_SB_PCI0XHC_DUAM \/_SB_PCI0XHC_DUAM\ [�O_H 
[�IO_HTRPHITRAP
piSMIF��
pi\._PR_DTSFp \._PR_TRPD�._PR_DTSF��
p TRPH��
p \._PR_TRPF�MIFAW._SB_PCI0PTMA �._PR_BGMAPTMS �._PR_BGMSPTIA
�._PR_BGIAO_INIp�OSYS�[\_OSI`�_OSILinux p�SYS�_OSIWindows 2001
p�OSYS�_OSIWindows 2001 SP1 p�OSYS�_OSIWindows 2001 SP2 p�OSYS�_OSIWindows
2001.1 p�OSYS�_OSIWindows 2006 p�OSYS�_OSIWindows 2009 p�OSYS�_OSIWindows 2012
p�OSYS�_OSIWindows 2013 p�OSYS�_OSIWindows 2015 p�OSYS�[\._PR_DTSE
��\._PR_DTSEp\._PR_DSAEGNHPGp ^.RP01HPEXp ^.RP02HPEXp ^.RP03HPEXp ^.RP04HPEXp
^.RP05HPEXp ^.RP06HPEXp ^.RP07HPEXp ^.RP08HPEXp ^.RP09HPEXp ^.RP10HPEXp
^.RP11HPEXp ^.RP12HPEXp ^.RP13HPEXp ^.RP14HPEXp ^.RP15HPEXp ^.RP16HPEXp
^.RP17HPEXp ^.RP18HPEXp ^.RP19HPEXp
^.RP20HPEXp^.RP01HPSXp^.RP02HPSXp^.RP03HPSXp^.RP04HPSXp^.RP05HPSXp^.RP06HPSXp^.RP07HPSXp^.RP08HPSXp^.RP09HPSXp^.RP10HPSXp^.RP11HPSXp^.RP12HPSXp^.RP13HPSXp^.RP14HPSXp^.RP15HPSXp^.RP16HPSXp^.RP17HPSXp^.RP18HPSXp^.RP19HPSXp^.RP20HPSXGNPMEp
^.RP01PMEXp ^.RP02PMEXp ^.RP03PMEXp ^.RP04PMEXp ^.RP05PMEXp ^.RP06PMEXp
^.RP07PMEXp ^.RP08PMEXp ^.RP09PMEXp ^.RP10PMEXp ^.RP11PMEXp ^.RP12PMEXp
^.RP13PMEXp ^.RP14PMEXp ^.RP15PMEXp ^.RP16PMEXp ^.RP17PMEXp ^.RP18PMEXp
^.RP19PMEXp
^.RP20PMEXp^.RP01PMSXp^.RP02PMSXp^.RP03PMSXp^.RP04PMSXp^.RP05PMSXp^.RP06PMSXp^.RP07PMSXp^.RP08PMSXp^.RP09PMSXp^.RP10PMSXp^.RP11PMSXp^.RP12PMSXp^.RP13PMSXp^.RP14PMSXp^.RP15PMSXp^.RP16PMSXp^.RP17PMSXp^.RP18PMSXp^.RP19PMSXp^.RP20PMSXE\
PICM PRWP @GPRWph�RWP pySS1_ `}`ySS2_
 `}`ySS3_
 `}`ySS4_
 `�{yi ` pi�RWP �z``��RWP �RWPH2_SB_OSCI OSCO OSCP A_OSC� STS0�
CAP0��0IDpSCGE��
n�'J�<�.{H��pCAP0OSCP�{CAP0
 p
OSCO��{SGMD

��TD3 {CAP0
;CAP0}STS0
STS0�{STS0 �TS0}STS0

STS0�{STS0 �TS0}STS0
STS0�[�$EPC__HID%�_STR1
.E n c l a v e P a g e C a c h e 1 . 0 _MLS;8en 1
.E n c l a v e P a g e C a c h e 1 . 0 RBUF3
0�   y G_CRS �BUF
EMIN�BUF
EMAX�BUF
&ELENp\._PR_EMNAEMINp\._PR_ELNGELENtr\._PR_EMNA\._PR_ELNG EMAX�BUFG_DSM_T_0
BUFX/  � � � � � � � � �B�
�ƞ�?�#'^�
�� � p� _T_0��T_0 ����T_0pSEC0�UFX pSEC1�UFX pSEC2�UFX
 pSEC3�UFX
 pSEC4�UFX
 pSEC5�UFX
 pSEC6�UFX
 pSEC7�UFX
 pSEC8�UFX
 �UFX� ��_STA ��\._PR_EPCS ��8_SB_[�BTKL_HIDINT3420 _STA
�_PS0_PS3PSTS _SB_[�SLPB_HIDA�_STA
N_PR_[�CPU0 [�CPU1 [�CPU2 [�CPU3 [�CPU4 [�CPU5
[�CPU6 [�CPU7 K(._PR_CPU0CPC1F

�  q y
 
�  4 y 
� t y 
�  t y 
� t y 
� y 
� y 
� y 
� @ � y 
� @ � y 
� w y 
�  p y CPC2N


�  q y 
� � y 
� q y 
� q y 
� q y 
� t y 
�  t y 
� t y 
� y 
� y 
� y 
� @ � y 
� @ � y 
� w y 
�  p y 
� 
 t y 
� t y H_SB_[�PAGD_HIDACPI000C 0_STA �_OSIProcessor Aggregator Device
���_PUR J._SB_PCI0[�PDRC_HIDA�_UIDBUF0J
�  � �   �   �  �  �  � � @ �  P� � � �� �  �  �  y F_CRS�UF0
MBR0pGMHBMBR0�UF0
DBR0pGDMBDBR0�UF0
EBR0pGEPBEBR0�UF0
(XBR0pGPCBXBR0�UF0
,XSZ0pGPCLXSZ0�UF0
pSXRApSXRBSXRA�UF0
tSXRLpSXRSSXRL��PTE�UF0
|HBAS�UF0
�LENpHPTBHBASp HLEN�UF0*BRTN ��DIDX   �/_SB_PCI0GFX0DD1FhBn_GPEGU_L69
��\/_SB_PCI0RP01VDID�\/_SB_PCI0RP01HPME�/_SB_PCI0RP01
��\/_SB_PCI0RP02VDID�\/_SB_PCI0RP02HPME�/_SB_PCI0RP02
��\/_SB_PCI0RP03VDID�\/_SB_PCI0RP03HPME�/_SB_PCI0RP03
��\/_SB_PCI0RP04VDID�\/_SB_PCI0RP04HPME�/_SB_PCI0RP04
��\/_SB_PCI0RP05VDID�\/_SB_PCI0RP05HPME�/_SB_PCI0RP05
��\/_SB_PCI0RP06VDID�\/_SB_PCI0RP06HPME�/_SB_PCI0RP06
��\/_SB_PCI0RP07VDID�\/_SB_PCI0RP07HPME�/_SB_PCI0RP07
��\/_SB_PCI0RP08VDID�\/_SB_PCI0RP08HPME�/_SB_PCI0RP08
��\/_SB_PCI0RP09VDID�\/_SB_PCI0RP09HPME�/_SB_PCI0RP09
��\/_SB_PCI0RP10VDID�\/_SB_PCI0RP10HPME�/_SB_PCI0RP10
��\/_SB_PCI0RP11VDID�\/_SB_PCI0RP11HPME�/_SB_PCI0RP11
��\/_SB_PCI0RP12VDID�\/_SB_PCI0RP12HPME�/_SB_PCI0RP12
��\/_SB_PCI0RP13VDID�\/_SB_PCI0RP13HPME�/_SB_PCI0RP13
��\/_SB_PCI0RP14VDID�\/_SB_PCI0RP14HPME�/_SB_PCI0RP14
��\/_SB_PCI0RP15VDID�\/_SB_PCI0RP15HPME�/_SB_PCI0RP15
��\/_SB_PCI0RP16VDID�\/_SB_PCI0RP16HPME�/_SB_PCI0RP16
��\/_SB_PCI0RP17VDID�\/_SB_PCI0RP17HPME�/_SB_PCI0RP17
��\/_SB_PCI0RP18VDID�\/_SB_PCI0RP18HPME�/_SB_PCI0RP18
��\/_SB_PCI0RP19VDID�\/_SB_PCI0RP19HPME�/_SB_PCI0RP19
��\/_SB_PCI0RP20VDID�\/_SB_PCI0RP20HPME�/_SB_PCI0RP20
�/_SB_PCI0PEG0
�/_SB_PCI0PEG0PEGP
_L61 H_L62 p GPEC�[\._PR_DTSE ��\._PR_DTSE�._TZ_TZ00
�\._TZ_TZ01
�[\._GPEHLVT HLVT4_L66 ��/_SB_PCI0GFX0GSSE�SMI\/_SB_PCI0GFX0GSCI_L67 p
 \/_SB_PCI0SBUSHSTS_L68 _L50 ��CON ��PRESA_L6F
 \._SB_UGPS��TD3�[\._GPEAL6F AL6F��GGP�[\._GPEP0L6
 P0L6\._SB_CAGSP0WK��1GP�[\._GPEP1L6 P1L6\._SB_CAGSP1WK��2GP�[\._GPEP2L6
 P2L6\._SB_CAGSP2WK\._SB_CGLSH2/_SB_PCI0RP01PXSX[�PXX
[�RPXX VDID [�LDR
D
[�FLDRDCAP DCTRSPLX9  � � � � � � � � �E
SPLCpDOM1��PLX pLIM1��PLX  pTIM1��PLX
 pDOM2��PLX
 pLIM2��PLX
  pTIM2��PLX

 pDOM3��PLX
 pLIM3��PLX
  pTIM3��PLX

 �PLXWANX'  � � � � � �KWANDp ��ANX pTRD0��ANX  pTRL0��ANX
 p��ANX
 pTRD1��ANX
  pTRL1��ANX

 �ANXWRDX 
 � �
 � �NWRDDpWDM1��RDX pCID1��RDX  pWDM2��RDX
 pCID2��RDX
  �RDXCWIST_T_0 �[VDID �pVDID_T_0��T_0�Z ����T_0�[ ��
��T_0�e1��
��T_0�f1����T_0������T_0������T_0������T_0������T_0�����T_0�����T_0�����T_0������H2/_SB_PCI0RP02PXSX[�PXX
[�RPXX VDID [�LDR
D
[�FLDRDCAP DCTRSPLX9  � � � � � � � � �E
SPLCpDOM1��PLX pLIM1��PLX  pTIM1��PLX
 pDOM2��PLX
 pLIM2��PLX
  pTIM2��PLX

 pDOM3��PLX
 pLIM3��PLX
  pTIM3��PLX

 �PLXWANX'  � � � � � �KWANDp ��ANX pTRD0��ANX  pTRL0��ANX
 p��ANX
 pTRD1��ANX
  pTRL1��ANX

 �ANXWRDX 
 � �
 � �NWRDDpWDM1��RDX pCID1��RDX  pWDM2��RDX
 pCID2��RDX
  �RDXCWIST_T_0 �[VDID �pVDID_T_0��T_0�Z ����T_0�[ ��
��T_0�e1��
��T_0�f1����T_0������T_0������T_0������T_0������T_0�����T_0�����T_0�����T_0������H2/_SB_PCI0RP03PXSX[�PXX
[�RPXX VDID [�LDR
D
[�FLDRDCAP DCTRSPLX9  � � � � � � � � �E
SPLCpDOM1��PLX pLIM1��PLX  pTIM1��PLX
 pDOM2��PLX
 pLIM2��PLX
  pTIM2��PLX

 pDOM3��PLX
 pLIM3��PLX
  pTIM3��PLX

 �PLXWANX'  � � � � � �KWANDp ��ANX pTRD0��ANX  pTRL0��ANX
 p��ANX
 pTRD1��ANX
  pTRL1��ANX

 �ANXWRDX 
 � �
 � �NWRDDpWDM1��RDX pCID1��RDX  pWDM2��RDX
 pCID2��RDX
  �RDXCWIST_T_0 �[VDID �pVDID_T_0��T_0�Z ����T_0�[ ��
��T_0�e1��
��T_0�f1����T_0������T_0������T_0������T_0������T_0�����T_0�����T_0�����T_0������H2/_SB_PCI0RP04PXSX[�PXX
[�RPXX VDID [�LDR
D
[�FLDRDCAP DCTRSPLX9  � � � � � � � � �E
SPLCpDOM1��PLX pLIM1��PLX  pTIM1��PLX
 pDOM2��PLX
 pLIM2��PLX
  pTIM2��PLX

 pDOM3��PLX
 pLIM3��PLX
  pTIM3��PLX

 �PLXWANX'  � � � � � �KWANDp ��ANX pTRD0��ANX  pTRL0��ANX
 p��ANX
 pTRD1��ANX
  pTRL1��ANX

 �ANXWRDX 
 � �
 � �NWRDDpWDM1��RDX pCID1��RDX  pWDM2��RDX
 pCID2��RDX
  �RDXCWIST_T_0 �[VDID �pVDID_T_0��T_0�Z ����T_0�[ ��
��T_0�e1��
��T_0�f1����T_0������T_0������T_0������T_0������T_0�����T_0�����T_0�����T_0������H2/_SB_PCI0RP05PXSX[�PXX
[�RPXX VDID [�LDR
D
[�FLDRDCAP DCTRSPLX9  � � � � � � � � �E
SPLCpDOM1��PLX pLIM1��PLX  pTIM1��PLX
 pDOM2��PLX
 pLIM2��PLX
  pTIM2��PLX

 pDOM3��PLX
 pLIM3��PLX
  pTIM3��PLX

 �PLXWANX'  � � � � � �KWANDp ��ANX pTRD0��ANX  pTRL0��ANX
 p��ANX
 pTRD1��ANX
  pTRL1��ANX

 �ANXWRDX 
 � �
 � �NWRDDpWDM1��RDX pCID1��RDX  pWDM2��RDX
 pCID2��RDX
  �RDXCWIST_T_0 �[VDID �pVDID_T_0��T_0�Z ����T_0�[ ��
��T_0�e1��
��T_0�f1����T_0������T_0������T_0������T_0������T_0�����T_0�����T_0�����T_0������H2/_SB_PCI0RP06PXSX[�PXX
[�RPXX VDID [�LDR
D
[�FLDRDCAP DCTRSPLX9  � � � � � � � � �E
SPLCpDOM1��PLX pLIM1��PLX  pTIM1��PLX
 pDOM2��PLX
 pLIM2��PLX
  pTIM2��PLX

 pDOM3��PLX
 pLIM3��PLX
  pTIM3��PLX

 �PLXWANX'  � � � � � �KWANDp ��ANX pTRD0��ANX  pTRL0��ANX
 p��ANX
 pTRD1��ANX
  pTRL1��ANX

 �ANXWRDX 
 � �
 � �NWRDDpWDM1��RDX pCID1��RDX  pWDM2��RDX
 pCID2��RDX
  �RDXCWIST_T_0 �[VDID �pVDID_T_0��T_0�Z ����T_0�[ ��
��T_0�e1��
��T_0�f1����T_0������T_0������T_0������T_0������T_0�����T_0�����T_0�����T_0������H2/_SB_PCI0RP07PXSX[�PXX
[�RPXX VDID [�LDR
D
[�FLDRDCAP DCTRSPLX9  � � � � � � � � �E
SPLCpDOM1��PLX pLIM1��PLX  pTIM1��PLX
 pDOM2��PLX
 pLIM2��PLX
  pTIM2��PLX

 pDOM3��PLX
 pLIM3��PLX
  pTIM3��PLX

 �PLXWANX'  � � � � � �KWANDp ��ANX pTRD0��ANX  pTRL0��ANX
 p��ANX
 pTRD1��ANX
  pTRL1��ANX

 �ANXWRDX 
 � �
 � �NWRDDpWDM1��RDX pCID1��RDX  pWDM2��RDX
 pCID2��RDX
  �RDXCWIST_T_0 �[VDID �pVDID_T_0��T_0�Z ����T_0�[ ��
��T_0�e1��
��T_0�f1����T_0������T_0������T_0������T_0������T_0�����T_0�����T_0�����T_0������H2/_SB_PCI0RP08PXSX[�PXX
[�RPXX VDID [�LDR
D
[�FLDRDCAP DCTRSPLX9  � � � � � � � � �E
SPLCpDOM1��PLX pLIM1��PLX  pTIM1��PLX
 pDOM2��PLX
 pLIM2��PLX
  pTIM2��PLX

 pDOM3��PLX
 pLIM3��PLX
  pTIM3��PLX

 �PLXWANX'  � � � � � �KWANDp ��ANX pTRD0��ANX  pTRL0��ANX
 p��ANX
 pTRD1��ANX
  pTRL1��ANX

 �ANXWRDX 
 � �
 � �NWRDDpWDM1��RDX pCID1��RDX  pWDM2��RDX
 pCID2��RDX
  �RDXCWIST_T_0 �[VDID �pVDID_T_0��T_0�Z ����T_0�[ ��
��T_0�e1��
��T_0�f1����T_0������T_0������T_0������T_0������T_0�����T_0�����T_0�����T_0������H2/_SB_PCI0RP09PXSX[�PXX
[�RPXX VDID [�LDR
D
[�FLDRDCAP DCTRSPLX9  � � � � � � � � �E
SPLCpDOM1��PLX pLIM1��PLX  pTIM1��PLX
 pDOM2��PLX
 pLIM2��PLX
  pTIM2��PLX

 pDOM3��PLX
 pLIM3��PLX
  pTIM3��PLX

 �PLXWANX'  � � � � � �KWANDp ��ANX pTRD0��ANX  pTRL0��ANX
 p��ANX
 pTRD1��ANX
  pTRL1��ANX

 �ANXWRDX 
 � �
 � �NWRDDpWDM1��RDX pCID1��RDX  pWDM2��RDX
 pCID2��RDX
  �RDXCWIST_T_0 �[VDID �pVDID_T_0��T_0�Z ����T_0�[ ��
��T_0�e1��
��T_0�f1����T_0������T_0������T_0������T_0������T_0�����T_0�����T_0�����T_0������H2/_SB_PCI0RP10PXSX[�PXX
[�RPXX VDID [�LDR
D
[�FLDRDCAP DCTRSPLX9  � � � � � � � � �E
SPLCpDOM1��PLX pLIM1��PLX  pTIM1��PLX
 pDOM2��PLX
 pLIM2��PLX
  pTIM2��PLX

 pDOM3��PLX
 pLIM3��PLX
  pTIM3��PLX

 �PLXWANX'  � � � � � �KWANDp ��ANX pTRD0��ANX  pTRL0��ANX
 p��ANX
 pTRD1��ANX
  pTRL1��ANX

 �ANXWRDX 
 � �
 � �NWRDDpWDM1��RDX pCID1��RDX  pWDM2��RDX
 pCID2��RDX
  �RDXCWIST_T_0 �[VDID �pVDID_T_0��T_0�Z ����T_0�[ ��
��T_0�e1��
��T_0�f1����T_0������T_0������T_0������T_0������T_0�����T_0�����T_0�����T_0������H2/_SB_PCI0RP11PXSX[�PXX
[�RPXX VDID [�LDR
D
[�FLDRDCAP DCTRSPLX9  � � � � � � � � �E
SPLCpDOM1��PLX pLIM1��PLX  pTIM1��PLX
 pDOM2��PLX
 pLIM2��PLX
  pTIM2��PLX

 pDOM3��PLX
 pLIM3��PLX
  pTIM3��PLX

 �PLXWANX'  � � � � � �KWANDp ��ANX pTRD0��ANX  pTRL0��ANX
 p��ANX
 pTRD1��ANX
  pTRL1��ANX

 �ANXWRDX 
 � �
 � �NWRDDpWDM1��RDX pCID1��RDX  pWDM2��RDX
 pCID2��RDX
  �RDXCWIST_T_0 �[VDID �pVDID_T_0��T_0�Z ����T_0�[ ��
��T_0�e1��
��T_0�f1����T_0������T_0������T_0������T_0������T_0�����T_0�����T_0�����T_0������H2/_SB_PCI0RP12PXSX[�PXX
[�RPXX VDID [�LDR
D
[�FLDRDCAP DCTRSPLX9  � � � � � � � � �E
SPLCpDOM1��PLX pLIM1��PLX  pTIM1��PLX
 pDOM2��PLX
 pLIM2��PLX
  pTIM2��PLX

 pDOM3��PLX
 pLIM3��PLX
  pTIM3��PLX

 �PLXWANX'  � � � � � �KWANDp ��ANX pTRD0��ANX  pTRL0��ANX
 p��ANX
 pTRD1��ANX
  pTRL1��ANX

 �ANXWRDX 
 � �
 � �NWRDDpWDM1��RDX pCID1��RDX  pWDM2��RDX
 pCID2��RDX
  �RDXCWIST_T_0 �[VDID �pVDID_T_0��T_0�Z ����T_0�[ ��
��T_0�e1��
��T_0�f1����T_0������T_0������T_0������T_0������T_0�����T_0�����T_0�����T_0������H2/_SB_PCI0RP13PXSX[�PXX
[�RPXX VDID [�LDR
D
[�FLDRDCAP DCTRSPLX9  � � � � � � � � �E
SPLCpDOM1��PLX pLIM1��PLX  pTIM1��PLX
 pDOM2��PLX
 pLIM2��PLX
  pTIM2��PLX

 pDOM3��PLX
 pLIM3��PLX
  pTIM3��PLX

 �PLXWANX'  � � � � � �KWANDp ��ANX pTRD0��ANX  pTRL0��ANX
 p��ANX
 pTRD1��ANX
  pTRL1��ANX

 �ANXWRDX 
 � �
 � �NWRDDpWDM1��RDX pCID1��RDX  pWDM2��RDX
 pCID2��RDX
  �RDXCWIST_T_0 �[VDID �pVDID_T_0��T_0�Z ����T_0�[ ��
��T_0�e1��
��T_0�f1����T_0������T_0������T_0������T_0������T_0�����T_0�����T_0�����T_0������H2/_SB_PCI0RP14PXSX[�PXX
[�RPXX VDID [�LDR
D
[�FLDRDCAP DCTRSPLX9  � � � � � � � � �E
SPLCpDOM1��PLX pLIM1��PLX  pTIM1��PLX
 pDOM2��PLX
 pLIM2��PLX
  pTIM2��PLX

 pDOM3��PLX
 pLIM3��PLX
  pTIM3��PLX

 �PLXWANX'  � � � � � �KWANDp ��ANX pTRD0��ANX  pTRL0��ANX
 p��ANX
 pTRD1��ANX
  pTRL1��ANX

 �ANXWRDX 
 � �
 � �NWRDDpWDM1��RDX pCID1��RDX  pWDM2��RDX
 pCID2��RDX
  �RDXCWIST_T_0 �[VDID �pVDID_T_0��T_0�Z ����T_0�[ ��
��T_0�e1��
��T_0�f1����T_0������T_0������T_0������T_0������T_0�����T_0�����T_0�����T_0������H2/_SB_PCI0RP15PXSX[�PXX
[�RPXX VDID [�LDR
D
[�FLDRDCAP DCTRSPLX9  � � � � � � � � �E
SPLCpDOM1��PLX pLIM1��PLX  pTIM1��PLX
 pDOM2��PLX
 pLIM2��PLX
  pTIM2��PLX

 pDOM3��PLX
 pLIM3��PLX
  pTIM3��PLX

 �PLXWANX'  � � � � � �KWANDp ��ANX pTRD0��ANX  pTRL0��ANX
 p��ANX
 pTRD1��ANX
  pTRL1��ANX

 �ANXWRDX 
 � �
 � �NWRDDpWDM1��RDX pCID1��RDX  pWDM2��RDX
 pCID2��RDX
  �RDXCWIST_T_0 �[VDID �pVDID_T_0��T_0�Z ����T_0�[ ��
��T_0�e1��
��T_0�f1����T_0������T_0������T_0������T_0������T_0�����T_0�����T_0�����T_0������H2/_SB_PCI0RP16PXSX[�PXX
[�RPXX VDID [�LDR
D
[�FLDRDCAP DCTRSPLX9  � � � � � � � � �E
SPLCpDOM1��PLX pLIM1��PLX  pTIM1��PLX
 pDOM2��PLX
 pLIM2��PLX
  pTIM2��PLX

 pDOM3��PLX
 pLIM3��PLX
  pTIM3��PLX

 �PLXWANX'  � � � � � �KWANDp ��ANX pTRD0��ANX  pTRL0��ANX
 p��ANX
 pTRD1��ANX
  pTRL1��ANX

 �ANXWRDX 
 � �
 � �NWRDDpWDM1��RDX pCID1��RDX  pWDM2��RDX
 pCID2��RDX
  �RDXCWIST_T_0 �[VDID �pVDID_T_0��T_0�Z ����T_0�[ ��
��T_0�e1��
��T_0�f1����T_0������T_0������T_0������T_0������T_0�����T_0�����T_0�����T_0������H2/_SB_PCI0RP17PXSX[�PXX
[�RPXX VDID [�LDR
D
[�FLDRDCAP DCTRSPLX9  � � � � � � � � �E
SPLCpDOM1��PLX pLIM1��PLX  pTIM1��PLX
 pDOM2��PLX
 pLIM2��PLX
  pTIM2��PLX

 pDOM3��PLX
 pLIM3��PLX
  pTIM3��PLX

 �PLXWANX'  � � � � � �KWANDp ��ANX pTRD0��ANX  pTRL0��ANX
 p��ANX
 pTRD1��ANX
  pTRL1��ANX

 �ANXWRDX 
 � �
 � �NWRDDpWDM1��RDX pCID1��RDX  pWDM2��RDX
 pCID2��RDX
  �RDXCWIST_T_0 �[VDID �pVDID_T_0��T_0�Z ����T_0�[ ��
��T_0�e1��
��T_0�f1����T_0������T_0������T_0������T_0������T_0�����T_0�����T_0�����T_0������H2/_SB_PCI0RP18PXSX[�PXX
[�RPXX VDID [�LDR
D
[�FLDRDCAP DCTRSPLX9  � � � � � � � � �E
SPLCpDOM1��PLX pLIM1��PLX  pTIM1��PLX
 pDOM2��PLX
 pLIM2��PLX
  pTIM2��PLX

 pDOM3��PLX
 pLIM3��PLX
  pTIM3��PLX

 �PLXWANX'  � � � � � �KWANDp ��ANX pTRD0��ANX  pTRL0��ANX
 p��ANX
 pTRD1��ANX
  pTRL1��ANX

 �ANXWRDX 
 � �
 � �NWRDDpWDM1��RDX pCID1��RDX  pWDM2��RDX
 pCID2��RDX
  �RDXCWIST_T_0 �[VDID �pVDID_T_0��T_0�Z ����T_0�[ ��
��T_0�e1��
��T_0�f1����T_0������T_0������T_0������T_0������T_0�����T_0�����T_0�����T_0������H2/_SB_PCI0RP19PXSX[�PXX
[�RPXX VDID [�LDR
D
[�FLDRDCAP DCTRSPLX9  � � � � � � � � �E
SPLCpDOM1��PLX pLIM1��PLX  pTIM1��PLX
 pDOM2��PLX
 pLIM2��PLX
  pTIM2��PLX

 pDOM3��PLX
 pLIM3��PLX
  pTIM3��PLX

 �PLXWANX'  � � � � � �KWANDp ��ANX pTRD0��ANX  pTRL0��ANX
 p��ANX
 pTRD1��ANX
  pTRL1��ANX

 �ANXWRDX 
 � �
 � �NWRDDpWDM1��RDX pCID1��RDX  pWDM2��RDX
 pCID2��RDX
  �RDXCWIST_T_0 �[VDID �pVDID_T_0��T_0�Z ����T_0�[ ��
��T_0�e1��
��T_0�f1����T_0������T_0������T_0������T_0������T_0�����T_0�����T_0�����T_0������H2/_SB_PCI0RP20PXSX[�PXX
[�RPXX VDID [�LDR
D
[�FLDRDCAP DCTRSPLX9  � � � � � � � � �E
SPLCpDOM1��PLX pLIM1��PLX  pTIM1��PLX
 pDOM2��PLX
 pLIM2��PLX
  pTIM2��PLX

 pDOM3��PLX
 pLIM3��PLX
  pTIM3��PLX

 �PLXWANX'  � � � � � �KWANDp ��ANX pTRD0��ANX  pTRL0��ANX
 p��ANX
 pTRD1��ANX
  pTRL1��ANX

 �ANXWRDX 
 � �
 � �NWRDDpWDM1��RDX pCID1��RDX  pWDM2��RDX
 pCID2��RDX
  �RDXCWIST_T_0 �[VDID �pVDID_T_0��T_0�Z ����T_0�[ ��
��T_0�e1��
��T_0�f1����T_0������T_0������T_0������T_0������T_0�����T_0�����T_0�����T_0������A._SB_PCI0(WHIT
� DockOemId DockSkuId

SELF �PcOemId PcSkuId ,/_SB_PCI0GFX0_DEP ��0ID�PEPD��
8/_SB_PCI0SAT0(_DEP ��S0ID�{PEPC
 �PEPD��
��0ID/_SB_PCI0I2C0_DEPPEPD/_SB_PCI0I2C1_DEPPEPD/_SB_PCI0I2C2_DEPPEPD/_SB_PCI0I2C3_DEPPEPD/_SB_PCI0I2C4_DEPPEPD/_SB_PCI0I2C5_DEPPEPD/_SB_PCI0SPI0_DEPPEPD/_SB_PCI0SPI1_DEPPEPD/_SB_PCI0UA00_DEPPEPD/_SB_PCI0UA01_DEPPEPD/_SB_PCI0UA02_DEPPEPD,/_SB_PCI0XHC__DEP
��0ID�PEPD�� F/_SB_PCI0RP01PXSXF_DEP ��AHCPNVM���0ID�OSYS��{PEPC
�PEPC

�PEPD� [�CCX

[�PCCXPIXXSCCXBCCX#PAHC��CCX��CCX
��IXX��$PNVM��CCX��CCX
��IXX
��F/_SB_PCI0RP02PXSXF_DEP ��AHCPNVM���0ID�OSYS��{PEPC �PEPC

�PEPD� [�CCX

[�PCCXPIXXSCCXBCCX#PAHC��CCX��CCX
��IXX��$PNVM��CCX��CCX
��IXX
��F/_SB_PCI0RP03PXSXF_DEP ��AHCPNVM���0ID�OSYS��{PEPC �PEPC

�PEPD� [�CCX

[�PCCXPIXXSCCXBCCX#PAHC��CCX��CCX
��IXX��$PNVM��CCX��CCX
��IXX
��F/_SB_PCI0RP04PXSXF_DEP ��AHCPNVM���0ID�OSYS��{PEPC �PEPC

�PEPD� [�CCX

[�PCCXPIXXSCCXBCCX#PAHC��CCX��CCX
��IXX��$PNVM��CCX��CCX
��IXX
��F/_SB_PCI0RP05PXSXF_DEP ��AHCPNVM���0ID�OSYS��{PEPC �PEPC

�PEPD� [�CCX

[�PCCXPIXXSCCXBCCX#PAHC��CCX��CCX
��IXX��$PNVM��CCX��CCX
��IXX
��F/_SB_PCI0RP06PXSXF_DEP ��AHCPNVM���0ID�OSYS��{PEPC �PEPC

�PEPD� [�CCX

[�PCCXPIXXSCCXBCCX#PAHC��CCX��CCX
��IXX��$PNVM��CCX��CCX
��IXX
��F/_SB_PCI0RP07PXSXF_DEP ��AHCPNVM���0ID�OSYS��{PEPC �PEPC

�PEPD� [�CCX

[�PCCXPIXXSCCXBCCX#PAHC��CCX��CCX
��IXX��$PNVM��CCX��CCX
��IXX
��F/_SB_PCI0RP08PXSXF_DEP ��AHCPNVM���0ID�OSYS��{PEPC �PEPC

�PEPD� [�CCX

[�PCCXPIXXSCCXBCCX#PAHC��CCX��CCX
��IXX��$PNVM��CCX��CCX
��IXX
��F/_SB_PCI0RP09PXSXF_DEP ��AHCPNVM���0ID�OSYS��{PEPC �PEPC

�PEPD� [�CCX

[�PCCXPIXXSCCXBCCX#PAHC��CCX��CCX
��IXX��$PNVM��CCX��CCX
��IXX
��F/_SB_PCI0RP10PXSXF_DEP ��AHCPNVM���0ID�OSYS��{PEPC �PEPC

�PEPD� [�CCX

[�PCCXPIXXSCCXBCCX#PAHC��CCX��CCX
��IXX��$PNVM��CCX��CCX
��IXX
��F/_SB_PCI0RP11PXSXF_DEP ��AHCPNVM���0ID�OSYS��{PEPC �PEPC

�PEPD� [�CCX

[�PCCXPIXXSCCXBCCX#PAHC��CCX��CCX
��IXX��$PNVM��CCX��CCX
��IXX
��F/_SB_PCI0RP12PXSXF_DEP ��AHCPNVM���0ID�OSYS��{PEPC �PEPC

�PEPD� [�CCX

[�PCCXPIXXSCCXBCCX#PAHC��CCX��CCX
��IXX��$PNVM��CCX��CCX
��IXX
��F/_SB_PCI0RP13PXSXF_DEP ��AHCPNVM���0ID�OSYS��{PEPC �PEPC

�PEPD� [�CCX

[�PCCXPIXXSCCXBCCX#PAHC��CCX��CCX
��IXX��$PNVM��CCX��CCX
��IXX
��F/_SB_PCI0RP14PXSXF_DEP ��AHCPNVM���0ID�OSYS��{PEPC �PEPC

�PEPD� [�CCX

[�PCCXPIXXSCCXBCCX#PAHC��CCX��CCX
��IXX��$PNVM��CCX��CCX
��IXX
��F/_SB_PCI0RP15PXSXF_DEP ��AHCPNVM���0ID�OSYS��{PEPC �PEPC

�PEPD� [�CCX

[�PCCXPIXXSCCXBCCX#PAHC��CCX��CCX
��IXX��$PNVM��CCX��CCX
��IXX
��F/_SB_PCI0RP16PXSXF_DEP ��AHCPNVM���0ID�OSYS��{PEPC �PEPC

�PEPD� [�CCX

[�PCCXPIXXSCCXBCCX#PAHC��CCX��CCX
��IXX��$PNVM��CCX��CCX
��IXX
��F/_SB_PCI0RP17PXSXF_DEP ��AHCPNVM���0ID�OSYS��{PEPC �PEPC

�PEPD� [�CCX

[�PCCXPIXXSCCXBCCX#PAHC��CCX��CCX
��IXX��$PNVM��CCX��CCX
��IXX
��F/_SB_PCI0RP18PXSXF_DEP ��AHCPNVM���0ID�OSYS��{PEPC �PEPC

�PEPD� [�CCX

[�PCCXPIXXSCCXBCCX#PAHC��CCX��CCX
��IXX��$PNVM��CCX��CCX
��IXX
��F/_SB_PCI0RP19PXSXF_DEP ��AHCPNVM���0ID�OSYS��{PEPC �PEPC

�PEPD� [�CCX

[�PCCXPIXXSCCXBCCX#PAHC��CCX��CCX
��IXX��$PNVM��CCX��CCX
��IXX
��F/_SB_PCI0RP20PXSXF_DEP ��AHCPNVM���0ID�OSYS��{PEPC �PEPC

�PEPD� [�CCX

[�PCCXPIXXSCCXBCCX#PAHC��CCX��CCX
��IXX��$PNVM��CCX��CCX
��IXX
��C._PR_CPU0GXDEP ADBGCPU0 DEP Call ��0IDADBGCPU0 DEP �\._SB_PEPD�ADBGCPU0
DEP NULL � C._PR_CPU1GXDEP ADBGCPU1 DEP Call ��0IDADBGCPU1 DEP
�\._SB_PEPD�ADBGCPU1 DEP NULL � C._PR_CPU2GXDEP ADBGCPU2 DEP Call
��0IDADBGCPU2 DEP �\._SB_PEPD�ADBGCPU2 DEP NULL � C._PR_CPU3GXDEP ADBGCPU3
DEP Call ��0IDADBGCPU3 DEP �\._SB_PEPD�ADBGCPU3 DEP NULL � C._PR_CPU4GXDEP
ADBGCPU4 DEP Call ��0IDADBGCPU4 DEP �\._SB_PEPD�ADBGCPU4 DEP NULL �
C._PR_CPU5GXDEP ADBGCPU5 DEP Call ��0IDADBGCPU5 DEP �\._SB_PEPD�ADBGCPU5
DEP NULL � C._PR_CPU6GXDEP ADBGCPU6 DEP Call ��0IDADBGCPU6 DEP
�\._SB_PEPD�ADBGCPU6 DEP NULL � C._PR_CPU7GXDEP ADBGCPU7 DEP Call
��0IDADBGCPU7 DEP �\._SB_PEPD�ADBGCPU7 DEP NULL � �_SB_[��PEPD_HIDINT33A1
_CIDA��_UIDDEVYLV)\_PR.CPU0   
�\_PR.CPU1   
�\_PR.CPU2   
�\_PR.CPU3   
�\_SB.PCI0.GFX0 
 
�\_SB.PCI0.SAT0  
�\_SB.PCI0.UA00 
 
�\_SB.PCI0.UA01 
 
�\_SB.PCI0.I2C0 
 
�\_SB.PCI0.I2C1 
 
�\_SB.PCI0.XHC 
 
�0INTELAUDIO\FUNC_01&VEN_10EC*   
\_SB.PCI0.PEMC 
 
�\_SB.PCI0.PSDC 
 
�\_SB.PCI0.I2C2 
 
�\_SB.PCI0.I2C3 
 
�\_SB.PCI0.I2C4 
 
�\_SB.PCI0.I2C5 
 
�\_SB.PCI0.UA02 
 
�\_SB.PCI0.SPI0 
 
�\_SB.PCI0.SPI1 
 
�$\_SB.PCI0.RP01.PXSX  
�$\_SB.PCI0.RP02.PXSX  
�$\_SB.PCI0.RP03.PXSX  
�$\_SB.PCI0.RP04.PXSX  
�$\_SB.PCI0.RP05.PXSX  
�$\_SB.PCI0.RP06.PXSX  
�$\_SB.PCI0.RP07.PXSX  
�$\_SB.PCI0.RP08.PXSX  
�$\_SB.PCI0.RP09.PXSX  
�$\_SB.PCI0.RP10.PXSX  
�$\_SB.PCI0.RP11.PXSX  
�$\_SB.PCI0.RP12.PXSX  
�$\_SB.PCI0.RP13.PXSX  
�$\_SB.PCI0.RP14.PXSX  
�$\_SB.PCI0.RP15.PXSX  
�$\_SB.PCI0.RP16.PXSX  
�$\_SB.PCI0.RP17.PXSX  
�$\_SB.PCI0.RP18.PXSX  
�$\_SB.PCI0.RP19.PXSX  
�$\_SB.PCI0.RP20.PXSX  
�BCCDHP,\_SB.PCI0.SAT0  
 
�
��1\_SB.PCI0.SAT0.PRT0  
 
�
��1\_SB.PCI0.SAT0.PRT1  
 
�
��1\_SB.PCI0.SAT0.PRT2  
 
�
��1\_SB.PCI0.SAT0.PRT3  
 
�
��3\_SB.PCI0.RP01.PXSX  
 
�
�� 3\_SB.PCI0.RP02.PXSX  
 
�
�� 3\_SB.PCI0.RP03.PXSX  
 
�
�� 3\_SB.PCI0.RP04.PXSX  
 
�
�� 3\_SB.PCI0.RP05.PXSX  
 
�
�� 3\_SB.PCI0.RP06.PXSX  
 
�
�� 3\_SB.PCI0.RP07.PXSX  
 
�
�� 3\_SB.PCI0.RP08.PXSX  
 
�
�� 3\_SB.PCI0.RP09.PXSX  
 
�
�� 3\_SB.PCI0.RP10.PXSX  
 
�
�� 3\_SB.PCI0.RP11.PXSX  
 
�
�� 3\_SB.PCI0.RP12.PXSX  
 
�
�� 3\_SB.PCI0.RP13.PXSX  
 
�
�� 3\_SB.PCI0.RP14.PXSX  
 
�
�� 3\_SB.PCI0.RP15.PXSX  
 
�
�� 3\_SB.PCI0.RP16.PXSX  
 
�
�� 3\_SB.PCI0.RP17.PXSX  
 
�
�� 3\_SB.PCI0.RP18.PXSX  
 
�
�� 3\_SB.PCI0.RP19.PXSX  
 
�
�� 3\_SB.PCI0.RP20.PXSX  
 
�
�� _STA ���SYS��0ID��L�DSMADBGsPEPC = �EPC �֓h
��l����� ��Гj��0ID � �I�PEPC
 �{SPST
 p��EVY
  ��^/PCI0RP01PXSXPAHC^^/PCI0RP01PXSXPNVMp��EVY
  ��^/PCI0RP02PXSXPAHC^^/PCI0RP02PXSXPNVMp��EVY
  ��^/PCI0RP03PXSXPAHC^^/PCI0RP03PXSXPNVMp��EVY
  ��^/PCI0RP04PXSXPAHC^^/PCI0RP04PXSXPNVMp��EVY
  ��^/PCI0RP05PXSXPAHC^^/PCI0RP05PXSXPNVMp��EVY
  ��^/PCI0RP06PXSXPAHC^^/PCI0RP06PXSXPNVMp��EVY
  ��^/PCI0RP07PXSXPAHC^^/PCI0RP07PXSXPNVMp��EVY
  ��^/PCI0RP08PXSXPAHC^^/PCI0RP08PXSXPNVMp��EVY
  ��^/PCI0RP09PXSXPAHC^^/PCI0RP09PXSXPNVMp��EVY
  ��^/PCI0RP10PXSXPAHC^^/PCI0RP10PXSXPNVMp��EVY
  ��^/PCI0RP11PXSXPAHC^^/PCI0RP11PXSXPNVMp��EVY
  ��^/PCI0RP12PXSXPAHC^^/PCI0RP12PXSXPNVMp��EVY
   ��^/PCI0RP13PXSXPAHC^^/PCI0RP13PXSXPNVMp��EVY
!  ��^/PCI0RP14PXSXPAHC^^/PCI0RP14PXSXPNVMp��EVY
"  ��^/PCI0RP15PXSXPAHC^^/PCI0RP15PXSXPNVMp��EVY
#  ��^/PCI0RP16PXSXPAHC^^/PCI0RP16PXSXPNVMp��EVY
$  ��^/PCI0RP17PXSXPAHC^^/PCI0RP17PXSXPNVMp��EVY
%  ��^/PCI0RP18PXSXPAHC^^/PCI0RP18PXSXPNVMp��EVY
&  ��^/PCI0RP19PXSXPAHC^^/PCI0RP19PXSXPNVMp��EVY
'  ��^/PCI0RP20PXSXPAHC^^/PCI0RP20PXSXPNVMp��EVY
(  ��PEPC
 p ��EVY
  ��PEPC
 p ��EVY
  ��PEPC
 ��PEPC
  p ��EVY
  ��PEPC
@ p ��EVY
	  ��PEPC
� p ��EVY

  ��PEPC  p ��EVY
  ��PEPC  p ��EVY
  ��PEPC  p ��EVY  p ��EVY  p ��EVY
  p ��EVY
  ��PEPC  p ��EVY
  ��PEPC  p ��EVY
  ��PEPC p ��EVY
  ��PEPC @ p ��EVY
  ��PEPC � p ��EVY
  ��PEPC  p ��EVY
  ��PEPC  p ��EVY
  ��PEPC  p ��EVY
  ��PEPC  p ��EVY
  �e�OSYS��^^/PCI0RP02PXSXWISTp
����EVY

   p ����EVY

 
 p��EVY
  �^^/PCI0RP03PXSXWISTp
����EVY

   p ����EVY

 
 p��EVY
  �^^/PCI0RP04PXSXWISTp
����EVY

   p ����EVY

 
 p��EVY
  �^^/PCI0RP05PXSXWISTp
����EVY

   p ����EVY

 
 p��EVY
  �^^/PCI0RP06PXSXWISTp
����EVY

   p ����EVY

 
 p��EVY
  �^^/PCI0RP07PXSXWISTp
����EVY

   p ����EVY

 
 p��EVY
  �^^/PCI0RP08PXSXWISTp
����EVY

   p ����EVY

 
 p��EVY
  �^^/PCI0RP09PXSXWISTp
����EVY

   p ����EVY

 
 p��EVY
  �^^/PCI0RP10PXSXWISTp
����EVY

   p ����EVY

 
 p��EVY
  �^^/PCI0RP11PXSXWISTp
����EVY

   p ����EVY

 
 p��EVY
  �^^/PCI0RP12PXSXWISTp
����EVY

   p ����EVY

 
 p��EVY
   �^^/PCI0RP13PXSXWISTp
����EVY
!
   p ����EVY
!
 
 p��EVY
!  �^^/PCI0RP14PXSXWISTp
����EVY
"
   p ����EVY
"
 
 p��EVY
"  �^^/PCI0RP15PXSXWISTp
����EVY
#
   p ����EVY
#
 
 p��EVY
#  �^^/PCI0RP16PXSXWISTp
����EVY
$
   p ����EVY
$
 
 p��EVY
$  �^^/PCI0RP17PXSXWISTp
����EVY
%
   p ����EVY
%
 
 p��EVY
%  �^^/PCI0RP18PXSXWISTp
����EVY
&
   p ����EVY
&
 
 p��EVY
&  �^^/PCI0RP19PXSXWISTp
����EVY
'
   p ����EVY
'
 
 p��EVY
'  �^^/PCI0RP20PXSXWISTp
����EVY
(
   p ����EVY
(
 
 p��EVY
(  �EVY��
�CCD��
��
��
��0IDGUAM��
��0IDGUAM �BUFN MBUF [�DBG � [�MDBGMDG0�$DB2H �MDENSHOWhMDGC
 pMBUFMDG0��'DW2H ph`zh
a{`
�
�2HavBUFNDB2H`)DD2H ph`zh
a{`�a�W2HavBUFNDW2H`GMBGS �MDENp�`BUFS`phBUFSMDGC
 �`MDGC�BUFSt�` v`pMBUFMDG0��GADBG �MDENp�`BUFS`phBUFSMDGC
 �`MDGC�BUFSt�` v`pMBUFMDG0��SHOW MDGCNTOCzh
 MDGCNTOCh LINEpBUFN`{`
`�`MDGC u`{`
`8MDGC ph�BUFBUFN rBUFNBUFN��UFN�UFN�FNUP_L
)UP_L phbyb
bMOVEbt bc�bp �BUFc ucvb4MOVE phdp BUFNt de�evep�MBUFd �BUFBUFN
uBUFNudNTOC {h
`��

r`
0`�r`
7`�[�+PSM__HID%� _UID _STR/
,P o w e r S h a r i n g M a n a g e r _STA ��SME���SPLX'  � � � � �
�ASPLCpPDT1��PLX pPLM1��PLX  pPTW1��PLX
 pPDT2��PLX
 pPLM2��PLX
  pPTW2��PLX

 �PLXDPLX@ - � �  � � � � � �- � �  � � � � � �HDPLCpDDT1��PLX
pDDP1��PLX  pDLI1���PLX
 pDPL1���PLX
  pDTW1���PLX

 pDMI1���PLX

 pDMA1���PLX

 pDMT1���PLX

 pDDT2��PLX
 pDDP2��PLX
  pDLI2���PLX

 pDPL2���PLX

  pDTW2���PLX


 pDMI2���PLX


 pDMA2���PLX


 pDMT2���PLX


 �PLX��AMT D_SB_[�ICAM_HIDINT33A3 IDFU IPWR _STA��VDF��G_DSM_T_0
��
�`]BH��s�p� _T_0��T_0 ��i �� ���T_0��� SGOV  p IDFU�SGOV
pIDFU����T_0
��� SGOV
  pIPWR�SGOV
 p IPWR����� �._SB_PCI0CIICB
_T_0 �pi_T_0��T_0 IIC0&
#�    � \_SB.PCI0.I2C0 y �IC0
DAD0phDAD0�IC0���T_0IIC1&
#�    � \_SB.PCI0.I2C1 y �IC1
DAD1phDAD1�IC1���T_0
IIC2&
#�    � \_SB.PCI0.I2C2 y �IC2
DAD2phDAD2�IC2���T_0
IIC3&
#�    � \_SB.PCI0.I2C3 y �IC3
DAD3phDAD3�IC3� ��T_0
IIC4&
#�    � \_SB.PCI0.I2C4 y �IC4
DAD4phDAD4�IC4�IIC5&
#�    � \_SB.PCI0.I2C5 y �IC5
DAD5phDAD5�IC5�GPINR
GPIR-
*�     ( �SB.PCI0.GPI0 y �PIR
PINFprw
i h PINF�PIR#DSMIyk
cyj
byi
a}ah`}`b`}`c`�#GPPIyk
cyj
byi
a}ah`}`b`}`c`�J!GRID _T_0 BUF_
	�ph_T_0��T_0 pL0H0�UF_ pL0H1�UF_ pL0H2�UF_
 pL0H3�UF_
 pL0H4�UF_
 pL0H5�UF_
 pL0H6�UF_
 pL0H7�UF_
 pL0H8�UF_
 ���T_0pL1H0�UF_ pL1H1�UF_ pL1H2�UF_
 pL1H3�UF_
 pL1H4�UF_
 pL1H5�UF_
 pL1H6�UF_
 pL1H7�UF_
 pL1H8�UF_
 ���T_0
pL2H0�UF_ pL2H1�UF_ pL2H2�UF_
 pL2H3�UF_
 pL2H4�UF_
 pL2H5�UF_
 pL2H6�UF_
 pL2H7�UF_
 pL2H8�UF_
 �pL3H0�UF_ pL3H1�UF_ pL3H2�UF_
 pL3H3�UF_
 pL3H4�UF_
 pL3H5�UF_
 pL3H6�UF_
 pL3H7�UF_
 pL3H8�UF_
 ��UF_�HCID _T_1 _T_0 �ph_T_0��T_0 pL0SM`���T_0pL1SM`���T_0
pL2SM`�pL3SM`�Mp`_T_1��T_1 �INT3471 ���T_1�INT33BE ���T_1
�INT3476 ���T_1
�INT3477 � ��T_1
�INT3474 ���T_1
�INT3473 ���T_1
�INT3475 ���T_1
�INT3478 ���T_1
�INT3479 ���T_1
	�INT347A ���T_1

�INT347B ��RIDh�I2CDEP _T_3 _T_2 _T_1 _T_0 �� �
�0TP�
pL0BS_T_0��T_0 �
DSC0I2C0���T_0�
DSC0I2C1���T_0
�
DSC0I2C2���T_0
�
DSC0I2C3���T_0
�
DSC0I2C4���T_0
�
DSC0I2C5��DSC0��0TP�CLP0���
�1TP�
pL1BS_T_1��T_1 �
DSC1I2C0���T_1�
DSC1I2C1���T_1
�
DSC1I2C2���T_1
�
DSC1I2C3���T_1
�
DSC1I2C4���T_1
�
DSC1I2C5��DSC1��1TP�CLP1��
�
�2TP�
pL2BS_T_2��T_2 �
DSC2I2C0���T_2�
DSC2I2C1���T_2
�
DSC2I2C2���T_2
�
DSC2I2C3���T_2
�
DSC2I2C4���T_2
�
DSC2I2C5��DSC2��2TP�CLP2��
�
�3TP�
pL3BS_T_3��T_3 �
DSC3I2C0���T_3�
DSC3I2C1���T_3
�
DSC3I2C2���T_3
�
DSC3I2C3���T_3
�
DSC3I2C4���T_3
�
DSC3I2C5��DSC3��3TP�CLP3�PCI0[�DSC0_ADR _HIDINT3472 _CIDINT3472
_DDNPMIC-CRDG _UID K_CRS p
y `��0GP pPINRC0P0C0G0a�a`��0GPpPINRC0P1C0G1a�a`��0GP
pPINRC0P2C0G2a�a`��0GP
pPINRC0P3C0G3a�a`�_STA �CL00��0TP��NCLDB PAR_#
  pC0TP�AR_ pC0CV�AR_
 �AR_I_DSM��
@F#y�O���uo�� �� �?�����0GP��
�PPIC0F0rw
C0G0 C0P0 C0I0C0A0��
�PPIC0F1rw
C0G1 C0P1 C0I1C0A1��
�PPIC0F2rw
C0G2 C0P2 C0I2C0A2��
�PPIC0F3rw
C0G3 C0P3 C0I3C0A3� [�DSC1_ADR _HIDINT3472 _CIDINT3472 _DDNPMIC-CRDG
_UIDK_CRS p
y `��1GP pPINRC1P0C1G0a�a`��1GPpPINRC1P1C1G1a�a`��1GP
pPINRC1P2C1G2a�a`��1GP
pPINRC1P3C1G3a�a`�_STA �CL01��1TP��NCLDB PAR_#
   pC1TP�AR_ pC1CV�AR_
 �AR_D_DSM��
@F#y�O���uo�� �� �?�����1GP��
�PPIC1F0rw
C1G0 C1P0 C1I0C1A0��
�PPIC1F1rw
C1G1 C1P1 C1I1C1A1��
�PPIC1F2rw
C1G2 C1P2 C1I2C1A2��
�PPIC1F3rw
C1G3 C1P3 C1I3C1A3[�DSC2_ADR _HIDINT3472 _CIDINT3472 _DDNPMIC-CRDG _UID
K_CRS p
y `��2GP pPINRC2P0C2G0a�a`��2GPpPINRC2P1C2G1a�a`��2GP
pPINRC2P2C2G2a�a`��2GP
pPINRC2P3C2G3a�a`�_STA �CL02��2TP��NCLDB PAR_#
   pC2TP�AR_ pC2CV�AR_
 �AR_D_DSM��
@F#y�O���uo�� �� �?�����2GP��
�PPIC2F0rw
C2G0 C2P0 C2I0C2A0��
�PPIC2F1rw
C2G1 C2P1 C2I1C2A1��
�PPIC2F2rw
C2G2 C2P2 C2I2C2A2��
�PPIC2F3rw
C2G3 C2P3 C2I3C2A3[�DSC3_ADR _HIDINT3472 _CIDINT3472 _DDNPMIC-CRDG _UID
K_CRS p
y `��3GP pPINRC3P0C3G0a�a`��3GPpPINRC3P1C3G1a�a`��3GP
pPINRC3P2C3G2a�a`��3GP
pPINRC3P3C3G3a�a`�_STA �CL03��3TP��NCLDB PAR_#
   pC3TP�AR_ pC3CV�AR_
 �AR_D_DSM��
@F#y�O���uo�� �� �?�����3GP��
�PPIC3F0rw
C3G0 C3P0 C3I0C3A0��
�PPIC3F1rw
C3G1 C3P1 C3I1C3A1��
�PPIC3F2rw
C3G2 C3P2 C3I2C3A2��
�PPIC3F3rw
C3G3 C3P3 C3I3C3A3[� CLP0_ADR 6_DEP �CL00��0IB
�I2C2��0IB
�I2C3�PCI0_UID _HIDINT3472 _CIDINT3472 _DDNPMIC-CRDG _CRS p
y `�IICBC0IAC0IB`�_STA �CL00��0TP��NCLDB PAR_#
  pC0TP�AR_ pC0CV�AR_
 �AR_D_PLDPLDB
� )  ���LDB
BPOSpC0PLBPOS�LDBJ_DSM��
Iu%&q�L�ĉ�H�� �� ��������
�SMI
C0IA C0IB��
�X}�G�v1vAK�� �� �����DSMB
4�SMB I2CC�SMB
DEV0pI2CCpDSMI
C0IA C0IBDEV0�SMB� [� CLP1_ADR 6_DEP �CL01��1IB
�I2C2��1IB
�I2C3�PCI0_HIDINT3472 _CIDINT3472 _DDNPMIC-CRDG _UID_CRS p
y `�IICBC1IAC1IB`�_STA �CL01��1TP��NCLDB PAR_#
   pC1TP�AR_ pC1CV�AR_
 �AR_D_PLDPLDB
� )  ���LDB
BPOSpC1PLBPOS�LDBJ_DSM��
Iu%&q�L�ĉ�H�� �� ��������
�SMI
C1IA C1IB��
�X}�G�v1vAK�� �� �����DSMB
4�SMB I2CC�SMB
DEV0pI2CCpDSMI
C1IA C1IBDEV0�SMB� [� CLP2_ADR 6_DEP �CL02��2IB
�I2C2��2IB
�I2C3�PCI0_HIDINT3472 _CIDINT3472 _DDNPMIC-CRDG _UID
_CRS p
y `�IICBC2IAC2IB`�_STA �CL02��2TP��NCLDB PAR_#
   pC2TP�AR_ pC2CV�AR_
 �AR_D_PLDPLDB
� )  ���LDB
BPOSpC2PLBPOS�LDBJ_DSM��
Iu%&q�L�ĉ�H�� �� ��������
�SMI
C2IA C2IB��
�X}�G�v1vAK�� �� �����DSMB
4�SMB I2CC�SMB
DEV0pI2CCpDSMI
C2IA C2IBDEV0�SMB� [� CLP3_ADR 6_DEP �CL03��3IB
�I2C2��3IB
�I2C3�PCI0_HIDINT3472 _CIDINT3472 _DDNPMIC-CRDG _UID
_CRS p
y `�IICBC3IAC3IB`�_STA �CL03��3TP��NCLDB PAR_#
   pC3TP�AR_ pC3CV�AR_
 �AR_D_PLDPLDB
� )  ���LDB
BPOSpC3PLBPOS�LDBJ_DSM��
Iu%&q�L�ĉ�H�� �� ��������
�SMI
C3IA C3IB��
�X}�G�v1vAK�� �� �����DSMB
4�SMB I2CC�SMB
DEV0pI2CCpDSMI
C3IA C3IBDEV0�SMB� [��NK0_ADR _STA �L0EN���_DEP
�L0EN�DEPL0CL��PCI0_UID _HID �CID _CID �CID F_DDN BUF_
pL0M0�UF_ pL0M1�UF_ pL0M2�UF_
 pL0M3�UF_
 pL0M4�UF_
 pL0M5�UF_
 pL0M6�UF_
 pL0M7�UF_
 pL0M8�UF_
 pL0M9�UF_
	 pL0MA�UF_

 pL0MB�UF_
 pL0MC�UF_
 pL0MD�UF_
 pL0ME�UF_
 pL0MF�UF_
 �BUF_�_PLDPLDB
� i  ���LDB
BPOSpL0PLBPOS�LDBC_CRS p
y `��0DI pIICBL0A0L0BSa�a`��0DIpIICBL0A1L0BSa�a`��0DI
pIICBL0A2L0BSa�a`��0DI
pIICBL0A3L0BSa�a`��0DI
pIICBL0A4L0BSa�a`��0DI
pIICBL0A5L0BSa�a`��0DI
pIICBL0A6L0BSa�a`��0DI
pIICBL0A7L0BSa�a`��0DI
pIICBL0A8L0BSa�a`��0DI
	pIICBL0A9L0BSa�a`��0DI

pIICBL0AAL0BSa�a`��0DI
pIICBL0ABL0BSa�a`�FSSDB PAR_@
l iV9��� ���  pL0DV�AR_ pL0CV�AR_ pCDIV�AR_
 pL0LU�AR_
 pL0NL�AR_
 pL0EE�AR_
N pL0VC�AR_
O pL0FS�AR_
R pL0DG�AR_
T �AR_
VDAT_pL0CKDAT_pL0CL�AR_
Z �AR_IO_DSM��
�*�(tA�_�y�� �� �����BUF_
pL0M0�UF_ pL0M1�UF_ pL0M2�UF_
 pL0M3�UF_
 pL0M4�UF_
 pL0M5�UF_
 pL0M6�UF_
 pL0M7�UF_
 pL0M8�UF_
 pL0M9�UF_
	 pL0MA�UF_

 pL0MB�UF_
 pL0MC�UF_
 pL0MD�UF_
 pL0ME�UF_
 pL0MF�UF_
 �BUF_��
�X}�G�v1vAK�� �� �����DSMB
4�SMB I2CC�SMB
DEV0�SMB
DEV1�SMB
DEV2�SMB
DEV3�SMB
DEV4�SMB
DEV5�SMB
DEV6�SMB
 DEV7�SMB
$DEV8�SMB
(DEV9�SMB
,DEVA�SMB
0DEVBpL0DII2CCpDSMIL0D0L0A0 L0BSDEV0pDSMIL0D1L0A1 L0BSDEV1pDSMIL0D2L0A2
L0BSDEV2pDSMIL0D3L0A3 L0BSDEV3pDSMIL0D4L0A4 L0BSDEV4pDSMIL0D5L0A5
L0BSDEV5pDSMIL0D6L0A6 L0BSDEV6pDSMIL0D7L0A7 L0BSDEV7pDSMIL0D8L0A8
L0BSDEV8pDSMIL0D9L0A9 L0BSDEV9pDSMIL0DAL0AA L0BSDEVApDSMIL0DBL0AB L0BSDEVB�SMB�
��
Iu%&q�L�ĉ�H�� �� �
�����0DI��
��0DI �SMIL0D0L0A0 L0BS����
��0DI�SMIL0D1L0A1 L0BS����
��0DI
�SMIL0D2L0A2 L0BS����
��0DI
�SMIL0D3L0A3 L0BS����
��0DI
�SMIL0D4L0A4 L0BS����
��0DI
�SMIL0D5L0A5 L0BS����
��0DI
�SMIL0D6L0A6 L0BS����
��0DI
�SMIL0D7L0A7 L0BS����
	��0DI
�SMIL0D8L0A8 L0BS����

��0DI
	�SMIL0D9L0A9 L0BS����
��0DI

�SMIL0DAL0AA L0BS����
��0DI
�SMIL0DBL0AB L0BS���[��NK1_ADR _STA �L1EN���_DEP
�L1EN�DEPL1CL��PCI0_UID_HID �CID_CID �CIDF_DDN BUF_
pL1M0�UF_ pL1M1�UF_ pL1M2�UF_
 pL1M3�UF_
 pL1M4�UF_
 pL1M5�UF_
 pL1M6�UF_
 pL1M7�UF_
 pL1M8�UF_
 pL1M9�UF_
	 pL1MA�UF_

 pL1MB�UF_
 pL1MC�UF_
 pL1MD�UF_
 pL1ME�UF_
 pL1MF�UF_
 �BUF_�_PLDPLDB
� i  ���LDB
BPOSpL1PLBPOS�LDBC_CRS p
y `��1DI pIICBL1A0L1BSa�a`��1DIpIICBL1A1L1BSa�a`��1DI
pIICBL1A2L1BSa�a`��1DI
pIICBL1A3L1BSa�a`��1DI
pIICBL1A4L1BSa�a`��1DI
pIICBL1A5L1BSa�a`��1DI
pIICBL1A6L1BSa�a`��1DI
pIICBL1A7L1BSa�a`��1DI
pIICBL1A8L1BSa�a`��1DI
	pIICBL1A9L1BSa�a`��1DI

pIICBL1AAL1BSa�a`��1DI
pIICBL1ABL1BSa�a`�FSSDB PAR_@
l iV9��� ���  pL1DV�AR_ pL1CV�AR_ pCDIV�AR_
 pL1LU�AR_
 pL1NL�AR_
 pL1EE�AR_
N pL1VC�AR_
O pL1FS�AR_
R pL1DG�AR_
T �AR_
VDAT_pL1CKDAT_pL1CL�AR_
Z �AR_IO_DSM��
�*�(tA�_�y�� �� �����BUF_
pL1M0�UF_ pL1M1�UF_ pL1M2�UF_
 pL1M3�UF_
 pL1M4�UF_
 pL1M5�UF_
 pL1M6�UF_
 pL1M7�UF_
 pL1M8�UF_
 pL1M9�UF_
	 pL1MA�UF_

 pL1MB�UF_
 pL1MC�UF_
 pL1MD�UF_
 pL1ME�UF_
 pL1MF�UF_
 �BUF_��
�X}�G�v1vAK�� �� �����DSMB
4�SMB I2CC�SMB
DEV0�SMB
DEV1�SMB
DEV2�SMB
DEV3�SMB
DEV4�SMB
DEV5�SMB
DEV6�SMB
 DEV7�SMB
$DEV8�SMB
(DEV9�SMB
,DEVA�SMB
0DEVBpL1DII2CCpDSMIL1D0L1A0 L1BSDEV0pDSMIL1D1L1A1 L1BSDEV1pDSMIL1D2L1A2
L1BSDEV2pDSMIL1D3L1A3 L1BSDEV3pDSMIL1D4L1A4 L1BSDEV4pDSMIL1D5L1A5
L1BSDEV5pDSMIL1D6L1A6 L1BSDEV6pDSMIL1D7L1A7 L1BSDEV7pDSMIL1D8L1A8
L1BSDEV8pDSMIL1D9L1A9 L1BSDEV9pDSMIL1DAL1AA L1BSDEVApDSMIL1DBL1AB L1BSDEVB�SMB�
��
Iu%&q�L�ĉ�H�� �� �
�����1DI��
��1DI �SMIL1D0L1A0 L1BS����
��1DI�SMIL1D1L1A1 L1BS����
��1DI
�SMIL1D2L1A2 L1BS����
��1DI
�SMIL1D3L1A3 L1BS����
��1DI
�SMIL1D4L1A4 L1BS����
��1DI
�SMIL1D5L1A5 L1BS����
��1DI
�SMIL1D6L1A6 L1BS����
��1DI
�SMIL1D7L1A7 L1BS����
	��1DI
�SMIL1D8L1A8 L1BS����

��1DI
	�SMIL1D9L1A9 L1BS����
��1DI

�SMIL1DAL1AA L1BS����
��1DI
�SMIL1DBL1AB L1BS���[��NK2_ADR _STA �L2EN���_DEP �L2EN�DEPL2CL��PCI0_UID
_HID �CID
_CID �CID
F_DDN BUF_
pL2M0�UF_ pL2M1�UF_ pL2M2�UF_
 pL2M3�UF_
 pL2M4�UF_
 pL2M5�UF_
 pL2M6�UF_
 pL2M7�UF_
 pL2M8�UF_
 pL2M9�UF_
	 pL2MA�UF_

 pL2MB�UF_
 pL2MC�UF_
 pL2MD�UF_
 pL2ME�UF_
 pL2MF�UF_
 �BUF_�_PLDPLDB
� i  ���LDB
BPOSpL2PLBPOS�LDBC_CRS p
y `��2DI pIICBL2A0L2BSa�a`��2DIpIICBL2A1L2BSa�a`��2DI
pIICBL2A2L2BSa�a`��2DI
pIICBL2A3L2BSa�a`��2DI
pIICBL2A4L2BSa�a`��2DI
pIICBL2A5L2BSa�a`��2DI
pIICBL2A6L2BSa�a`��2DI
pIICBL2A7L2BSa�a`��2DI
pIICBL2A8L2BSa�a`��2DI
	pIICBL2A9L2BSa�a`��2DI

pIICBL2AAL2BSa�a`��2DI
pIICBL2ABL2BSa�a`�FSSDB PAR_@
l iV9��� ���  pL2DV�AR_ pL2CV�AR_ pCDIV�AR_
 pL2LU�AR_
 pL2NL�AR_
 pL2EE�AR_
N pL2VC�AR_
O pL2FS�AR_
R pL2DG�AR_
T �AR_
VDAT_pL2CKDAT_pL2CL�AR_
Z �AR_IO_DSM��
�*�(tA�_�y�� �� �����BUF_
pL2M0�UF_ pL2M1�UF_ pL2M2�UF_
 pL2M3�UF_
 pL2M4�UF_
 pL2M5�UF_
 pL2M6�UF_
 pL2M7�UF_
 pL2M8�UF_
 pL2M9�UF_
	 pL2MA�UF_

 pL2MB�UF_
 pL2MC�UF_
 pL2MD�UF_
 pL2ME�UF_
 pL2MF�UF_
 �BUF_��
�X}�G�v1vAK�� �� �����DSMB
4�SMB I2CC�SMB
DEV0�SMB
DEV1�SMB
DEV2�SMB
DEV3�SMB
DEV4�SMB
DEV5�SMB
DEV6�SMB
 DEV7�SMB
$DEV8�SMB
(DEV9�SMB
,DEVA�SMB
0DEVBpL2DII2CCpDSMIL2D0L2A0 L2BSDEV0pDSMIL2D1L2A1 L2BSDEV1pDSMIL2D2L2A2
L2BSDEV2pDSMIL2D3L2A3 L2BSDEV3pDSMIL2D4L2A4 L2BSDEV4pDSMIL2D5L2A5
L2BSDEV5pDSMIL2D6L2A6 L2BSDEV6pDSMIL2D7L2A7 L2BSDEV7pDSMIL2D8L2A8
L2BSDEV8pDSMIL2D9L2A9 L2BSDEV9pDSMIL2DAL2AA L2BSDEVApDSMIL2DBL2AB L2BSDEVB�SMB�
��
Iu%&q�L�ĉ�H�� �� �
�����2DI��
��2DI �SMIL2D0L2A0 L2BS����
��2DI�SMIL2D1L2A1 L2BS����
��2DI
�SMIL2D2L2A2 L2BS����
��2DI
�SMIL2D3L2A3 L2BS����
��2DI
�SMIL2D4L2A4 L2BS����
��2DI
�SMIL2D5L2A5 L2BS����
��2DI
�SMIL2D6L2A6 L2BS����
��2DI
�SMIL2D7L2A7 L2BS����
	��2DI
�SMIL2D8L2A8 L2BS����

��2DI
	�SMIL2D9L2A9 L2BS����
��2DI

�SMIL2DAL2AA L2BS����
��2DI
�SMIL2DBL2AB L2BS���[��NK3_ADR _STA �L3EN���_DEP �L3EN�DEPL3CL��PCI0_UID
_HID �CID
_CID �CID
F_DDN BUF_
pL3M0�UF_ pL3M1�UF_ pL3M2�UF_
 pL3M3�UF_
 pL3M4�UF_
 pL3M5�UF_
 pL3M6�UF_
 pL3M7�UF_
 pL3M8�UF_
 pL3M9�UF_
	 pL3MA�UF_

 pL3MB�UF_
 pL3MC�UF_
 pL3MD�UF_
 pL3ME�UF_
 pL3MF�UF_
 �BUF_�_PLDPLDB
� i  ���LDB
BPOSpL3PLBPOS�LDBC_CRS p
y `��3DI pIICBL3A0L3BSa�a`��3DIpIICBL3A1L3BSa�a`��3DI
pIICBL3A2L3BSa�a`��3DI
pIICBL3A3L3BSa�a`��3DI
pIICBL3A4L3BSa�a`��3DI
pIICBL3A5L3BSa�a`��3DI
pIICBL3A6L3BSa�a`��3DI
pIICBL3A7L3BSa�a`��3DI
pIICBL3A8L3BSa�a`��3DI
	pIICBL3A9L3BSa�a`��3DI

pIICBL3AAL3BSa�a`��3DI
pIICBL3ABL3BSa�a`�FSSDB PAR_@
l iV9��� ���  pL3DV�AR_ pL3CV�AR_ pCDIV�AR_
 pL3LU�AR_
 pL3NL�AR_
 pL3EE�AR_
N pL3VC�AR_
O pL3FS�AR_
R pL3DG�AR_
T �AR_
VDAT_pL3CKDAT_pL3CL�AR_
Z �AR_IO_DSM��
�*�(tA�_�y�� �� �����BUF_
pL3M0�UF_ pL3M1�UF_ pL3M2�UF_
 pL3M3�UF_
 pL3M4�UF_
 pL3M5�UF_
 pL3M6�UF_
 pL3M7�UF_
 pL3M8�UF_
 pL3M9�UF_
	 pL3MA�UF_

 pL3MB�UF_
 pL3MC�UF_
 pL3MD�UF_
 pL3ME�UF_
 pL3MF�UF_
 �BUF_��
�X}�G�v1vAK�� �� �����DSMB
4�SMB I2CC�SMB
DEV0�SMB
DEV1�SMB
DEV2�SMB
DEV3�SMB
DEV4�SMB
DEV5�SMB
DEV6�SMB
 DEV7�SMB
$DEV8�SMB
(DEV9�SMB
,DEVA�SMB
0DEVBpL3DII2CCpDSMIL3D0L3A0 L3BSDEV0pDSMIL3D1L3A1 L3BSDEV1pDSMIL3D2L3A2
L3BSDEV2pDSMIL3D3L3A3 L3BSDEV3pDSMIL3D4L3A4 L3BSDEV4pDSMIL3D5L3A5
L3BSDEV5pDSMIL3D6L3A6 L3BSDEV6pDSMIL3D7L3A7 L3BSDEV7pDSMIL3D8L3A8
L3BSDEV8pDSMIL3D9L3A9 L3BSDEV9pDSMIL3DAL3AA L3BSDEVApDSMIL3DBL3AB L3BSDEVB�SMB�
��
Iu%&q�L�ĉ�H�� �� �
�����3DI��
��3DI �SMIL3D0L3A0 L3BS����
��3DI�SMIL3D1L3A1 L3BS����
��3DI
�SMIL3D2L3A2 L3BS����
��3DI
�SMIL3D3L3A3 L3BS����
��3DI
�SMIL3D4L3A4 L3BS����
��3DI
�SMIL3D5L3A5 L3BS����
��3DI
�SMIL3D6L3A6 L3BS����
��3DI
�SMIL3D7L3A7 L3BS����
	��3DI
�SMIL3D8L3A8 L3BS����

��3DI
	�SMIL3D9L3A9 L3BS����
��3DI

�SMIL3DAL3AA L3BS����
��3DI
�SMIL3DBL3AB L3BS�����CHVSPTL��SDWE I/_SB_PCI0PSDCH_CRS ��SYS��
y RBUFF
R�     '  ( \_SB.PCI0.GPI0 �    ( \_SB.PCI0.GPI0 y �BUF
SDIP�BUF
?SDGP��DWEpGNUM SDIPpGNUM SDGP��DWE
pGNUM SDIPpGNUM SDGP�BUF[�GNS  �w [�LGNS RES0WMIF _S0_
�SS1__S1_ �SS3__S3_
 �SS4__S4_
 _S5_
  PTS_�hWAK_UEFI6 LENOVOCB-01  ACPI  5��G����6 $BVDT$ $ $CDCN27WW
$Skylake $05.05.26 ���������������������������������������������������E$ �  $
>  $ ��$_MSC_VER=@$VEREXBVersion0,BVersion1,BVersion2
$PRODEXBY511,BY513,BY710 $CCBVEXCVersion0,CVersion1,CVersion2 $RDATE$ESRT
'c=S�u|I�(�� $ENDOFBVDT�����EFIB �ENOVOCB-01  ACPI  ���L����6  MSDMU
�NOVOCB-01  ACPI     YNGHP-W2BMB-RRCGW-WH7Y2-TMVCMSSDTQ �NOVOCB-01  ACPI
 [�ANV ��[�"SANVASLB
IMONIGDSIBTTIPATIPSCIBIAISSCIDMSIF1EHVCOGSMIPAVPCADLCSTENSTENDIDDID1
DID2 DID3 DID4 DID5 DID6 DID7 DID8 DID9 DIDA DIDB DIDC DIDD DIDE DIDF DIDX NXD1
NXD2 NXD3 NXD4 NXD5 NXD6 NXD7 NXD8 NXDX LIDSKSV0
KSV1BRTLALSEALAFLLOWLHIHALFPIMTPEDPVSGMDSGFLSGGPHRE0HRG0
HRA0PWE0PWG0 PWA0P1GPHRE1HRG1 HRA1PWE1PWG1 PWA1P2GPHRE2HRG2
HRA2PWE2PWG2 PWA2DLPWDLHREECPXBAS GBASNVGA NVHA AMDA
LTRXOBFXLTRYOBFYLTRZOBFZSMSLSNSLP0UBP1UBP2UBPCSLPBGEM64B@M64L@CPEX
EEC1EEC2SBN0SBN1SBN2M32B M32L P0WK P1WK P2WK \._SB_PCI0LTRS OBFS O
\_GPE7P0L6 �\._SB_ISMEP0WK\._SB_SHPOP0WK�/_SB_PCI0PEG0
7P1L6 �\._SB_ISMEP1WK\._SB_SHPOP1WK�/_SB_PCI0PEG1
7P2L6 �\._SB_ISMEP2WK\._SB_SHPOP2WK�/_SB_PCI0PEG2
G%\/_SB_PCI0PEG0[�EGR
�0[�PEGR PSTS OGENG PMEG_PRW �PRW
i
HPMEpPSTS_PRT �PICM�R02�R02_INI pLTRXLTRSpOBFXOBFSLTRV G_DSM_T_0
��
��S5zM���M�p� _T_0��T_0 p `��i
�LTRS}`
@`�OBFS}`
`��i
�ECR1}` `�ECR1}` `��` }``����T_0
��i
�OBFS�
  ��
 ���T_0
��i
�LTRSp{zSMSL


 �TRV p{SMSL�LTRV p{zSNSL


 �TRV
 p{SNSL�LTRV
 �TRV�����T_0
��CR1��i
����T_0
	��CR1��i
�P��� ;P0EW �WKEN��SGGP ��GGP\._SB_SGOVP0WK\._SB_SHPOP0WK
B\/_SB_PCI0PEG0PEGP[�CIS  [�PCIS PVIDPDID_PRW �PRW
i
M%\/_SB_PCI0PEG1WKEN [�EGR
�0[�PEGR PSTS OGENG PMEG_PRW �PRW
i
HPMEpPSTS_PRT �PICM�R0A�R0A_INI pLTRYLTRSpOBFYOBFSLTRV G_DSM_T_0
��
��S5zM���M�p� _T_0��T_0 p `��i
�LTRS}`
@`�OBFS}`
`��i
�ECR1}` `�ECR1}` `��` }``����T_0
��i
�OBFS�
  ��
 ���T_0
��i
�LTRSp{zSMSL


 �TRV p{SMSL�LTRV p{zSNSL


 �TRV
 p{SNSL�LTRV
 �TRV�����T_0
��CR1��i
����T_0
	��CR1��i
�P��� ;P1EW �WKEN��P1GP ��1GP\._SB_SGOVP1WK\._SB_SHPOP1WK
B\/_SB_PCI0PEG1PEGP[�CIS  [�PCIS PVIDPDID_PRW �PRW
i
M%\/_SB_PCI0PEG2WKEN [�EGR
�0[�PEGR PSTS OGENG PMEG_PRW �PRW
i
HPMEpPSTS_PRT �PICM�R0B�R0B_INI pLTRZLTRSpOBFZOBFSLTRV G_DSM_T_0
��
��S5zM���M�p� _T_0��T_0 p `��i
�LTRS}`
@`�OBFS}`
`��i
�ECR1}` `�ECR1}` `��` }``����T_0
��i
�OBFS�
  ��
 ���T_0
��i
�LTRSp{zSMSL


 �TRV p{SMSL�LTRV p{zSNSL


 �TRV
 p{SNSL�LTRV
 �TRV�����T_0
��CR1��i
����T_0
	��CR1��i
�P��� ;P2EW �WKEN��P2GP ��2GP\._SB_SGOVP2WK\._SB_SHPOP2WK
B\/_SB_PCI0PEG2PEGP[�CIS  [�PCIS PVIDPDID_PRW �PRW
i
�\/_SB_PCI0GFX0&_DOSp{h
 DSEN��h
 �[HDOS HDOS�_DOD ��MTPpNDID�p NDID��DIDL pSDDLDIDLDID1��DDL2
pSDDLDDL2DID2��DDL3 pSDDLDDL3DID3��DDL4 pSDDLDDL4DID4��DDL5 pSDDLDDL5DID5��DDL6
pSDDLDDL6DID6��DDL7 pSDDLDDL7DID7��DDL8 pSDDLDDL8DID8��DDL9 pSDDLDDL9DID9��DD10
pSDDLDD10DIDA��DD11 pSDDLDD11DIDB��DD12 pSDDLDD12DIDC��DD13 pSDDLDD13DIDD��DD14
pSDDLDD14DIDE��DD15 pSDDLDD15DIDF��DIDTMP1���MTPp � �MP1 �p}  DID1 �MP1
�MP1��DID
TMP2��p}  DID1 �MP2 ��MTPp � �MP2 �p}  DID2 �MP2 �MP2��DID
TMP3���p}  DID1 �MP3 p}  DID2 �MP3 ��MTPp � �MP3
 �p}  DID3 �MP3
 �MP3� �DID
TMP4����p}  DID1 �MP4 p}  DID2 �MP4 p}  DID3 �MP4
 ��MTPp � �MP4
 �p}  DID4 �MP4
 �MP4�
�DID
TMP5�����p}  DID1 �MP5 p}  DID2 �MP5 p}  DID3 �MP5
 p}  DID4 �MP5
 ��MTPp � �MP5
 �p}  DID5 �MP5
 �MP5��DID
TMP6 ������p}  DID1 �MP6 p}  DID2 �MP6 p}  DID3 �MP6
 p}  DID4 �MP6
 p}  DID5 �MP6
 ��MTPp � �MP6
 �p}  DID6 �MP6
 �MP6��DID
TMP7%�������p}  DID1 �MP7 p}  DID2 �MP7 p}  DID3 �MP7
 p}  DID4 �MP7
 p}  DID5 �MP7
 p}  DID6 �MP7
 ��MTPp � �MP7
 �p}  DID7 �MP7
 �MP7��DID
TMP8*��������p}  DID1 �MP8 p}  DID2 �MP8 p}  DID3 �MP8
 p}  DID4 �MP8
 p}  DID5 �MP8
 p}  DID6 �MP8
 p}  DID7 �MP8
 ��MTPp � �MP8
 �p}  DID8 �MP8
 �MP8��DID
	TMP9/ ���������p}  DID1 �MP9 p}  DID2 �MP9 p}  DID3 �MP9
 p}  DID4 �MP9
 p}  DID5 �MP9
 p}  DID6 �MP9
 p}  DID7 �MP9
 p}  DID8 �MP9
 ��MTPp � �MP9
 �p}  DID9 �MP9
 �MP9��DID

TMPA4
����������p}  DID1 �MPA p}  DID2 �MPA p}  DID3 �MPA
 p}  DID4 �MPA
 p}  DID5 �MPA
 p}  DID6 �MPA
 p}  DID7 �MPA
 p}  DID8 �MPA
 p}  DID9 �MPA
 ��MTPp � �MPA
	 �p}  DIDA �MPA
	 �MPA��DID
TMPB9�����������p}  DID1 �MPB p}  DID2 �MPB p}  DID3 �MPB
 p}  DID4 �MPB
 p}  DID5 �MPB
 p}  DID6 �MPB
 p}  DID7 �MPB
 p}  DID8 �MPB
 p}  DID9 �MPB
 p}  DIDA �MPB
	 ��MTPp � �MPB

 �p}  DIDB �MPB

 �MPB��DID
TMPC>������������p}  DID1 �MPC p}  DID2 �MPC p}  DID3
�MPC
 p}  DID4 �MPC
 p}  DID5 �MPC
 p}  DID6 �MPC
 p}  DID7 �MPC
 p}  DID8 �MPC
 p}  DID9 �MPC
 p}  DIDA �MPC
	 p}  DIDB �MPC

 ��MTPp � �MPC
 �p}  DIDC �MPC
 �MPC��DID
TMPDD�������������p}  DID1 �MPD p}  DID2 �MPD p}  DID3 �MPD
 p}  DID4 �MPD
 p}  DID5 �MPD
 p}  DID6 �MPD
 p}  DID7 �MPD
 p}  DID8 �MPD
 p}  DID9 �MPD
 p}  DIDA �MPD
	 p}  DIDB �MPD

 p}  DIDC �MPD
 ��MTPp � �MPD
 �p}  DIDD �MPD
 �MPD��DID
TMPEI��������������p}  DID1 �MPE p}  DID2 �MPE p}  DID3
�MPE
 p}  DID4 �MPE
 p}  DID5 �MPE
 p}  DID6 �MPE
 p}  DID7 �MPE
 p}  DID8 �MPE
 p}  DID9 �MPE
 p}  DIDA �MPE
	 p}  DIDB �MPE

 p}  DIDC �MPE
 p}  DIDD �MPE
 ��MTPp � �MPE
 �p}  DIDE �MPE
 �MPE��DID
TMPFN���������������p}  DID1 �MPF p}  DID2 �MPF p} 
DID3 �MPF
 p}  DID4 �MPF
 p}  DID5 �MPF
 p}  DID6 �MPF
 p}  DID7 �MPF
 p}  DID8 �MPF
 p}  DID9 �MPF
 p}  DIDA �MPF
	 p}  DIDB �MPF

 p}  DIDC �MPF
 p}  DIDD �MPF
 p}  DIDE �MPF
 ��MTPp � �MPF
 �p}  DIDF �MPF
 �MPF��DID
TMPGC����������������p}  DID1 �MPG p}  DID2 �MPG p} 
DID3 �MPG
 p}  DID4 �MPG
 p}  DID5 �MPG
 p}  DID6 �MPG
 p}  DID7 �MPG
 p}  DID8 �MPG
 p}  DID9 �MPG
 p}  DIDA �MPG
	 p}  DIDB �MPG

 p}  DIDC �MPG
 p}  DIDD �MPG
 p}  DIDE �MPG
 p}  DIDF �MPG
 p � �MPG
 �MPG� [� DD01F_ADR�� DID1  pEDPVpNXD1NXDXpDID1DIDX���ID1 ����D1
_DCS �DDSDID1(_DGS ��{SGMD
 [SNXD �XD1�DDSDID1_DSSDSSTh[� DD02I_ADR�� DID2  p
EDPVpNXD2NXDXpDID2DIDX���ID2 ����D2 _DCS ��IDS ��DDSDID2(_DGS ��{SGMD
 [SNXD �XD2�DDSDID2_DSSDSSTh[�
DD03I_ADR�� DID3  p
EDPVpNXD3NXDXpDID3DIDX���ID3 ����D3 _DCS ��ID3 ���DDSDID3(_DGS ��{SGMD
 [SNXD �XD3�DDSDID3_DSSDSSTh[�
DD04I_ADR�� DID4  p
EDPVpNXD4NXDXpDID4DIDX���ID4 ����D4 _DCS ��ID4 ���DDSDID4(_DGS ��{SGMD
 [SNXD �XD4�DDSDID4_DSSDSSTh[�
DD05I_ADR�� DID5  p
EDPVpNXD5NXDXpDID5DIDX���ID5 ����D5 _DCS ��ID5 ���DDSDID5(_DGS ��{SGMD
 [SNXD �XD5�DDSDID5_DSSDSSTh[�
DD06I_ADR�� DID6  p
EDPVpNXD6NXDXpDID6DIDX���ID6 ����D6 _DCS ��ID6 ���DDSDID6(_DGS ��{SGMD
 [SNXD �XD6�DDSDID6_DSSDSSTh[�
DD07I_ADR�� DID7  p
EDPVpNXD7NXDXpDID7DIDX���ID7 ����D7 _DCS ��ID7 ���DDSDID7(_DGS ��{SGMD
 [SNXD �XD7�DDSDID7_DSSDSSTh[�
DD08I_ADR�� DID8  p
EDPVpNXD8NXDXpDID8DIDX���ID8 ����D8 _DCS ��ID8 ���DDSDID8(_DGS ��{SGMD
 [SNXD �XD8�DDSDID8_DSSDSSTh[�
DD09I_ADR�� DID9  p
	EDPVpNXD8NXDXpDID9DIDX� ��ID9 � ���D9 _DCS ��ID9 ���DDSDID9(_DGS
	��{SGMD
 [SNXD �XD8�DDSDID9_DSSDSSTh[�
DD0AI_ADR�� DIDA  p

EDPVpNXD8NXDXpDIDADIDX�
��IDA �
���DA _DCS ��IDA ���DDSDIDA(_DGS ��{SGMD
 [SNXD �XD8�DDSDIDA_DSSDSSTh[�
DD0BI_ADR�� DIDB  p
EDPVpNXD8NXDXpDIDBDIDX���IDB ����DB _DCS ��IDB ���DDSDIDB(_DGS ��{SGMD
 [SNXD �XD8�DDSDIDB_DSSDSSTh[�
DD0CI_ADR�� DIDC  p
EDPVpNXD8NXDXpDIDCDIDX���IDC ����DC _DCS ��IDC ���DDSDIDC(_DGS ��{SGMD
 [SNXD �XD8�DDSDIDC_DSSDSSTh[�
DD0DI_ADR�� DIDD  p
EDPVpNXD8NXDXpDIDDDIDX���IDD ����DD _DCS ��IDD ���DDSDIDD(_DGS ��{SGMD
 [SNXD �XD8�DDSDIDD_DSSDSSTh[�
DD0EI_ADR�� DIDE  p
EDPVpNXD8NXDXpDIDEDIDX���IDE ����DE _DCS ��IDE ���DDSDIDE(_DGS ��{SGMD
 [SNXD �XD8�DDSDIDE_DSSDSSTh[�
DD0FI_ADR�� DIDF  p
EDPVpNXD8NXDXpDIDFDIDX���IDF ����DF _DCS ��IDC ���DDSDIDF(_DGS ��{SGMD
 [SNXD �XD8�DDSDIDF_DSSDSSTh[�DD1F_ADR��DPV ����DX _DCS ��DPV
���DDSDIDX(_DGS ��{SGMD
 [SNXD �XDX�DDSDIDX_DSSDSSThH_BCL ��SYS��BCL7�Og
P
2 
































!
"
#
$
%
&
'
(
)
*
+
,
-
.
/
0
1
2
3
4
5
6
7
8
9
:
;
<
=
>
?
@
A
B
C
D
E
F
G
H
I
J
K
L
M
N
O
P
Q
R
S
T
U
V
W
X
Y
Z
[
\
]
^
_
`
a
b
c
d-_BCM��� �h
d\/_SB_PCI0GFX0AINThphBRTL_BQC �RTLDSDDLuNDIDp{h `}
�a��IDL`���DL2`���DL3`���DL4`���DL5`���DL6`���DL7`���DL8`���DL9`���D10`���D11`���D12`���D13`���D14`���D15`��BCDDSp{h
`��`���ADL`���AL2`���AL3`���AL4`���AL5`���AL6`���AL7`���AL8`��HNDDSp{h
`��`���ADL`���DL2`���DL3`���DL4`���DL5`���DL6`���DL7`���DL8`��DSST��h �
�NSTECSTE0\._SB_PCI0[�CHP
@
��MCHP @
AUDE H%TASM
 [�GDP
@
��IGDP @ GIVD GUMA  GMFN  @FASLE GSSEGSSBGSES 0 CDVL  LBPC
0ASLS [�GDM ASLB [� IGDM SIGN@SIZE OVER SVER@VVER@GVER@MBOX DMOD PCON DVER@
@JDRDY CSTS CEVT @
DIDL DDL2 DDL3 DDL4 DDL5 DDL6 DDL7 DDL8 CPDL CPL2 CPL3 CPL4 CPL5 CPL6 CPL7 CPL8
CADL CAL2 CAL3 CAL4 CAL5 CAL6 CAL7 CAL8 NADL NDL2 NDL3 NDL4 NDL5 NDL6 NDL7 NDL8
ASLP TIDX CHPD CLID CDCK SXSW EVTS CNOT NRDY DDL9 DD10 DD11 DD12 DD13 DD14 DD15
CPL9 CP10 CP11 CP12 CP13 CP14 CP15 SCIEGEFCGXFCGESF PARM DSLP @zARDY ASLC
TCHE ALSI BCLP PFIT CBLV BCLM@CPFM EPFM PLUT@%PFMB CCDV PCFT SROT IUER FDSP@FDSS
STAT @#GVD1�PHED BDDC@�DBTB2

8� 
?���  pp8p� ~CDCT'
�
�M
�M 
�MSUCCNVLD
CRIT
NCRT
EQGSCI@GBDA��ESF pYPARMp GESF�UCC��ESFp�0 PARM��0ID}PARM PARMp
GESF�UCC��ESF
{PARM �RM{PARMy�DBTBIBTT
 PARM}IBTTPARMPARMp GESF�UCC��ESF
pIPSCPARM}PARMyIPAT
 PARMrPARM PARM}PARMyLIDS
 PARMrPARM  PARM}PARMyIBIA
 PARMp GESF�UCC��ESF
pGIVDPARMPARMPARM}PARMyGMFN PARM}PARM PARM}PARMyIDMS
 PARM}y��CDCTHVCO CDVL
 PARMPARMpGESF�UCC��ESF

p PARM�ISSC}PARM
PARMp GESF�UCC��ESF
pKSV0PARMpKSV1GESF�UCCp GESF�RITN/SBCB��ESF p PARMp݇ PARMp GESF�UCC��ESFp
GESFp PARM�UCC��ESF
p GESFp PARM�UCC��ESF
p GESFp PARM�UCC��ESF
p GESFp PARM�UCC��ESF
��S0ID�SYS���PARM
�GUAM��PARM
�GUAM
��ARM pCLID`�{ � {CLID
CLIDGLIDCLIDp GESFp PARM�UCC��ESF
��S0ID�SYS�p{zPARM

�
� \GUAM p GESFp PARM�UCC��ESF
	{PARM
�Tp GESFp PARM�UCC��ESF

{PARM
�C�{zPARM

�PARM

�TvIPAT{zPARM

IBIAp GESFp PARM�UCC��ESF
{zPARM IF1E�{PARM � {zPARM

IDMS�{zPARM

IDMSp GESFp PARM�UCC��ESF
p GESFp PARM�UCC��ESF
pyLIDS
 PARMrPARM PARMp GESF�UCC��ESF
�{PARM ��PARM pISSC�p GESF�RIT�p ISSCp GESFp PARM�UCC��ESF
p GESFp PARM�UCC��ESF
{PARM
PAVPp GESFp PARM�UCCp GESF�UCC��EFC
pGBDAGXFC��EFC
pSBCBGXFCp GEFCpCPSCp GSSEp SCIE�PDRD �DRDYPSTS ��STS
["ASLP�CSTS
MGNOT�PDRD�phCEVTp
CSTS��CHPD � �/_SB_PCI0GFX0i�[HNOT HNOTh��/_SB_PCI0GFX0
� GHDSphTIDX�NOT 5GLID��p
CLID�phCLID�GNOT
 }CLID �LID��GDCKphCDCK�NOT
 PARD ��RDY["ASLP�ARDY6IUEH {IUER
�UERIUERyh IUER��h
�INT
 ��INTh OAINT��TCHEyh ��PARD����
�h
pyh ASLCpASLEp b��b
�SLC ["
ub���
� CPFM{CPFM
`{EPFM
a���{a
 p
PFIT��{a
 p
PFIT�pPFIT��
�{a
 p
PFIT��{a pPFIT�p
PFIT��
�{a pPFIT��{a
 p
PFIT�p
PFIT�PFIT
PFIT}PFIT �FITp
ASLC���pxwi
� BCLP}BCLP �CLPp
ASLC��� piALSIpASLC��pASLE�GK_DSM_T_0 �J�
�[>�����KHp� _T_0��T_0 ��piGfx Supported Functions Bitmap [1���D� �T_0�
�p Adapter Power State Notification [1��S0ID�SYS����k
�GUAMp{�k
�� \GUAM
��� pCLID`�{ � {CLID
CLIDGLIDCLID��:��T_0
��pDisplay Power State Notification [1��S0ID�SYS�p{�k
�
� \GUAM ��4��T_0
��pBIOS POST Completion Notification [1��0��T_0
��pPre-Hires Set Mode [1��-��T_0
��pPost-Hires Set Mode [1��+��T_0
��pSetDisplayDeviceNotification [1��'��T_0
��pSetBootDevicePreference [1{�k
�T��$��T_0
��pSetPanelPreference [1{�k
�C�{�k
��
�TvIPAT{z�k


IBIA����T_0
	��pFullScreenDOS [1����T_0

��pAPM Complete [1pyLIDS
 `r` `����T_0
��pGetBootDisplayPreference [1}y�k

 y�k

 `{` �`y�DBTBIBTT
 `}IBTT``����T_0
��pGetPanelDetails [1pIPSC`}`yIPAT
 `r` `}`yLIDS
 `r`  `}`yIBIA
 `����T_0
��pGetInternalGraphics [1pGIVD```}`yGMFN `}` `}`yIDMS
 `}y��CDCTHVCO CDVL
 ``����T_0
��pGetAKSV [1KSVP
 � �KSV0�SVP pKSV1�SVP �SVP� <\_SB_[�SKC0_HIDINT3470 _CIDA�_STA
��MTP
���5\/_SB_PCI0GFX0[�SKC0_ADR �_STA ��MTP����\._SB_PCI0HBRB HBRD HBRF
IVID�EBA PION PIOF PBUS PDEV PFUN EBUS EDEV EFN0 EFN1INDX POFF PLEN
VIOF DSOF
CPOF
4SBOF
ELC0 ECP0�H0VI H0DI ELC1 ECP1�H1VI H1DI ELC2 ECP2�H2VI H2DI TIDX
OTSD MXPG
FBDL CBDL MBDL HSTR LREV TCNT LDLY,[�PG0 rXBAS � [�OPG0 P0VIP0DI
DSO0 @CPO0 H= P0LD K P0L2P0L0 I. P0VC N| P0LS L Q0L2Q0L0 �HST0
P0TR � BSP1 @ BSP2 @ BSP3 @ BSP4 @ BSP5 @ BSP6 @ BSP7 @
BSP8 � P0AP J P0RM LP0LT LKLRV0 [�CS0 rXBASySBN0

�PCS0D0VI @S0VIS0DI[�AP0 rrXBASySBN0
 EECP
[�CAP0 @LCP0 LCT0[�PG1 rXBAS � [�OPG1 P1VIP1DI DSO1 @CPO1 H= P1LD
K P1L2P1L0 I. P1VC N| P1LS L Q1L2Q1L0 �HST1 P1TR � P1AP J P1RM
LP1LT LKLRV1 [�CS1 rXBASySBN1

�PCS1D1VI @S1VIS1DI[�AP1 rrXBASySBN1
 EEC1
[�CAP1 @LCP1 LCT1[�PG2 rXBAS � [�OPG2 P2VIP2DI DSO2 @CPO2 H= P2LD
K P2L2P2L0 I. P2VC N| P2LS L Q2L2Q2L0 �HST2 P2TR � P2AP J P2RM
LP2LT LKLRV2 [�CS2 rXBASySBN2

�PCS2D2VI @S2VIS2DI[�AP2 rrXBASySBN2
 EEC2
[�CAP2 @LCP2 LCT2[�CD0 XBAS
�MCD0 MODI/PEGSp `��CPEX� � ��{MODI

p`�G+PGON phPION��ION ��GGP ����ION��1GP ����ION
��2GP �p\XBASPEBApGDEVPIONPDEVpGFUNPIONPFUNSCLK  ���SCLK PCRA
���CLK ["
��CHKPION �GPPRPION��SYS���ION p P0APp P0RM���IONp P1APp P1RM���ION
p P2APp P2RM��PBGE
�SBDLPIONPUABPIONpGUBCPIONCBDLpGMXBPIONMBDL��BDLMBDLpMBDLCBDLPDUBPIONCBDL��ION p
P0LDpP0TRp TCNT��CNTLDLY��0VC �"
rTCNT
TCNT���IONp P1LDpP1TRp TCNT��CNTLDLY��1VC �"
rTCNT
TCNT���ION
p P2LDpP2TRp TCNT��CNTLDLY��2VC �"
rTCNT
TCNT�LKENPION��ION pH0VIS0VIpH0DIS0DI}{ELC0
C {LCT0� LCT0���IONpH1VIS1VIpH1DIS1DI}{ELC1
C {LCT1� LCT1���ION
pH2VIS2VIpH2DIS2DI}{ELC2
C {LCT2� LCT2�C&PGOF phPIOF��IOF ��GGP ����IOF��1GP ����IOF
��2GP �p\XBASPEBApGDEVPIOFPDEVpGFUNPIOFPFUNSCLK  ��CHKPIOF ���
pLCT0ELC0pS0VIH0VIpS0DIH0DIpLCP0ECP0���pLCT1ELC1pS1VIH1VIpS1DIH1DIpLCP1ECP1���
pLCT2ELC2pS2VIH2VIpS2DIH2DIpLCP2ECP2��SYS���IOF pP0LDp TCNT��CNTLDLY��0LT
�"
rTCNT
TCNTpP0RMp
P0AP� ��IOFpP1LDp TCNT��CNTLDLY��1LT
�"
rTCNT
TCNTpP1RMp
P1AP���IOF
pP2LDp TCNT��CNTLDLY��2LT
�"
rTCNT
TCNTpP2RMp
P2AP��PBGE �SBDLPIOFpGMXBPIOFMBDLPDUBPIOFMBDL�LKDSPIOF���SCLK PCRO
��SCLK ["
GPPRPIOF ��OSYS�DIWKPIOF�AMMRBphg}gyi
 g}gyj
 g}gyk
 g}glg[�CI0 g[�PCI0TEMP�EMPBMMWBphg}gyi
 g}gyj
 g}gyk
 g}glg[�CI0 g[�PCI0TEMPpmTEMPBMMRWphg}gyi
 g}gyj
 g}gyk
 g}glg[�CI0 g
[�PCI0TEMP�EMPCMMWWphg}gyi
 g}gyj
 g}gyk
 g}glg[�CI0 g
[�PCI0TEMPpmTEMPBMMRDphg}gyi
 g}gyj
 g}gyk
 g}glg[�CI0 g
[�PCI0TEMP �EMPCMMWDphg}gyi
 g}gyj
 g}gyk
 g}glg[�CI0 g
[�PCI0TEMP pmTEMPFGULCpMMRDPEBAPBUSPDEVPFUN
�zg
g{g
?gphfzf
f{f
?f��ftgf`�p `�L GMXB�� pHST0HSTR���pHST1HSTR���
pHST2HSTRzHSTR
HSTR{HSTR
HSTR�� ��STR
p
`�p
`�����STR
p
`���STR p
`���
��STR p
`�O!PUABp FBDLp CBDL�� pHST0HSTRpLRV0LREV���pHST1HSTRpLRV1LREV���
pHST2HSTRpLRV2LREVzHSTR
HSTR{HSTR
HSTRzLREV
LREV{LREVLREV�� ��STR
p FBDLp
CBDL���REV p FBDLp
CBDL�p
FBDLp
CBDL� ����STR
��REV p
FBDLp
CBDL�p FBDLp
CBDL���STR ��REV p
FBDLp
CBDL�p
FBDLp
CBDL���
��STR ��REV p
FBDLp
CBDL�p FBDLp
CBDLpINDX��CBDL �
�INDXCBDL��0VIIVID���P0VIIVID��BDL p BSP1��BDLp BSP2��BDL
p BSP3��BDL
p BSP4��BDL
p BSP5��BDL
p BSP6��BDL
p BSP7��BDL
p BSP8uFBDLuINDX@!PDUBp FBDLpiCBDL��BDL ���
pHST0HSTRpLRV0LREV���pHST1HSTRpLRV1LREV���
pHST2HSTRpLRV2LREVzHSTR
HSTR{HSTR
HSTRzLREV
LREV{LREVLREV�� ��STR
��REV pt
CBDL FBDL�p FBDL���REV pt
CBDL FBDL�p
FBDL�����STR
��REV pt
CBDL FBDL�p FBDL���STR ��REV pt
CBDL FBDL�p
FBDL���
��STR ��REV pt
CBDL FBDL�p FBDLpINDX�
�INDXCBDL��0VIIVID���P0VIIVID��BDL pBSP1��BDLpBSP2��BDL
pBSP3��BDL
pBSP4��BDL
pBSP5��BDL
pBSP6��BDL
pBSP7��BDL
pBSP8uFBDLuINDX>SBDL�� ��0UB ������1UB ����
��2UB ����BGUBCp g�� pLCP0f���pLCP1f���
pLCP2f�� ��0UB
�LCfepxe
 g���P0UB pP0UBg�����1UB
�LCfepxe
 g���P1UB pP1UBg���
��2UB
�LCfepxe
 g���P2UB pP2UBg�ILKEN{CPEX
c�� �� pP0L0["
p `�P0L0��
�"
u`���pP1L0["
p `�P0L0��
�"
u`���
pP2L0["
p `�P0L0��
�"
u`���c �� pQ0L0["
p `�Q0L0��
�"
u`���pQ1L0["
p `�Q1L0��
�"
u`���
pQ2L0["
p `�Q2L0��
�"
u`ILKDS{CPEX
c�� �� pP0L2["
p `�P0L2��
�"
u`���pP1L2["
p `�P1L2��
�"
u`���
pP2L2["
p `�P2L2��
�"
u`���c �� pQ0L2["
p `�Q0L2��
�"
u`���pQ1L2["
p `�Q1L2��
�"
u`���
pQ2L2["
p `�Q2L2��
�"
u`DIWK�� ������
#GDEV�� p`���p`��
p`�$GFUN�� p `���p`��
p
`�JCCHK�� pP0VIg���pP1VIg���
pP2VIg��IVID���h pP0VIg��IVID��� �� ��GPISGGPPWE0PWG0PWA0
�����GPIP1GPPWE1PWG1PWA1 ���
��GPIP2GPPWE2PWG2PWA2 ������
��GPISGGPPWE0PWG0PWA0�����GPIP1GPPWE1PWG1PWA1���
��GPIP2GPPWE2PWG2PWA2��NNTFY�� �/_SB_PCI0PEG0i����/_SB_PCI0PEG1i���
�/_SB_PCI0PEG2iHGPPR� � �� SGPOSGGPHRE0HRG0HRA0SGPOSGGPPWE0PWG0PWA0
��SGPOP1GPHRE1HRG1HRA1SGPOP1GPPWE1PWG1PWA1 ��
SGPOP2GPHRE2HRG2HRA2SGPOP2GPPWE2PWG2PWA2 �����
SGPOSGGPHRE0HRG0HRA0SGPOSGGPPWE0PWG0PWA0["DLPWSGPOSGGPHRE0HRG0HRA0
["DLHR��SGPOP1GPHRE1HRG1HRA1SGPOP1GPPWE1PWG1PWA1["DLPWSGPOP1GPHRE1HRG1HRA1
["DLHR��
SGPOP2GPHRE2HRG2HRA2SGPOP2GPPWE2PWG2PWA2["DLPWSGPOP2GPHRE2HRG2HRA2
["DLHR2SGPO�� �l{ll���[\._SB_SGOV \._SB_SGOVjl5SGPI���[\._SB_GGOV
p\._SB_GGOVj`�� �`{``�DBGP4 )LENOVOCB-01  ACPI   H� @� DBG2a �ENOVOCB-01 
ACPI  ,  5  & �  "  @� \_SB.PCI0.UA02 SSDT| 0LENOVOCB-01  ACPI  F
\/_SB_PCI0XHC_RHUBNGPLD
PCKG
[�PCKG
REV_pREV_[�PCKG
@VISIphVISI[�PCKG
W
GPOSpiGPOS�CKG!GUPC PCKG
�h�CKG �CKG3\/_SB_PCI0XHC_RHUBHS01_UPC �UPC_PLD
�PLD4\/_SB_PCI0XHC_RHUBHS02_UPC �UPC_PLD �PLD
4\/_SB_PCI0XHC_RHUBHS03_UPC �UPC_PLD �PLD
3\/_SB_PCI0XHC_RHUBHS04_UPC �UPC _PLD �PLD 4\/_SB_PCI0XHC_RHUBHS05_UPC
�UPC_PLD �PLD
H\/_SB_PCI0XHC_RHUBHS06_UPC �UPC_PLD �PLD
[�WCAM _ADR�'_PLDPLDY
�   �LDY_RMV �3\/_SB_PCI0XHC_RHUBHS07_UPC �UPC _PLD �PLD
3\/_SB_PCI0XHC_RHUBHS08_UPC �UPC _PLD �PLD 3\/_SB_PCI0XHC_RHUBHS09_UPC
�UPC _PLD �PLD 3\/_SB_PCI0XHC_RHUBHS10_UPC �UPC _PLD �PLD
4\/_SB_PCI0XHC_RHUBHS11_UPC �UPC_PLD �PLD
3\/_SB_PCI0XHC_RHUBHS12_UPC �UPC _PLD �PLD 3\/_SB_PCI0XHC_RHUBHS13_UPC
�UPC _PLD �PLD 3\/_SB_PCI0XHC_RHUBHS14_UPC �UPC _PLD �PLD
3\/_SB_PCI0XHC_RHUBUSR1_UPC �UPC _PLD �PLD 3\/_SB_PCI0XHC_RHUBUSR2_UPC
�UPC _PLD �PLD 4\/_SB_PCI0XHC_RHUBSS01_UPC �UPC_PLD �PLD
4\/_SB_PCI0XHC_RHUBSS02_UPC �UPC_PLD �PLD
3\/_SB_PCI0XHC_RHUBSS03_UPC �UPC _PLD �PLD 3\/_SB_PCI0XHC_RHUBSS04_UPC
�UPC _PLD �PLD 3\/_SB_PCI0XHC_RHUBSS05_UPC �UPC _PLD �PLD
A\/_SB_PCI0XHC_RHUBSS06_UPC �UPC_PLD �PLD
[� CRGB=_STA[�HCM {MEMB �� [�XHCM �SP06��P06�� _ADR�_UPCUPCP
� �PCP+_PLDPLDY
� $  ���LDY[� CDPT=_STA[�HCM {MEMB �� [�XHCM �SP06��P06��
_ADR�_UPCUPCP
� �PCP+_PLDPLDY
� $  ���LDY3\/_SB_PCI0XHC_RHUBSS07_UPC �UPC _PLD �PLD
3\/_SB_PCI0XHC_RHUBSS08_UPC �UPC _PLD �PLD 3\/_SB_PCI0XHC_RHUBSS09_UPC
�UPC _PLD �PLD 3\/_SB_PCI0XHC_RHUBSS10_UPC �UPC _PLD �PLD ASF!� LENOVOCB-01
 ACPI   � W  , �o h� �o h � �o h �    ����  ��W 
� \h����� ASPT4 %LENOVOCB-01  ACPI  BOOT( �OVOCB-01  ACPI  D HPET8
�OVOCB-01  ACPI  ��@ � � LPIT� �ENOVOCB-01  ACPI  8  ` 0u � @ 2 8 
 ` 0u � @ 2 APIC� �ENOVOCB-01  ACPI  �        
  � 
  
		         MCFG<
		 _LENOVOCB-01  ACPI  � � SSDT� LENOVOCB-01  ACPI  O*\
		 [�*EIAD_HID%��_S0W /_STAADBGEIAD STA ��ID_
 ����IDF��B&_DSM_T_0 PECE PECD DFUE DFUD OLDV PECV DFUV �"�
<�#O�ͮ"�ϠM �� � p� _T_0��T_0 ADBGEIAD F:0 ��� �T_0ADBGEIAD F:1 ��BID_
 p�k PECEp�k PECDp\/_SB_PCI0GEXPGEPS
OLDV\/_SB_PCI0GEXPSGEP
PECE��ECD ["PECD\/_SB_PCI0GEXPSGEP
OLDV����T_0
ADBGEIAD F:2 p�k DFUEp�k DFUD��ID_
 p\._SB_GGOV OLDV\._SB_SGOV DFUE�p\._SB_GGOV OLDV\._SB_SGOV
 DFUE��FUD ["DFUD��ID_
 \._SB_SGOV OLDV�\._SB_SGOV OLDV����T_0
ADBGEIAD F:3 ��ID_
 p\._SB_GGOV DFUVpPECV�p\._SB_GGOV DFUVp\/_SB_PCI0GEXPGEPS
PECV�
PECVDFUV� ��SSDT� �NOVOCB-01  ACPI  E\/_SB_PCI0SAT0[�PRID_ADR B_GTM
PBUF
 �BUF PIO0�BUF
DMA0�BUF
PIO1�BUF
DMA1�BUF
FLAGp
�0p
�1p
DMA0p
DMA1p
FLAG�BUF_STM[�MAST_ADR [�SLAV_ADR[�SECD_ADRB_GTM PBUF
 �BUF PIO0�BUF
DMA0�BUF
PIO1�BUF
DMA1�BUF
FLAGp
�0p
�1p
DMA0p
DMA1p
FLAG�BUF_STM[�MAST_ADR [�SLAV_ADRSSDT��ENOVOCB-01  ACPI 
O<\_TZ_ETMDTHLD
xYBT4
7YBT3
@YBT2
IYBT1
PYBT0
[[�TZ00PTMP�N_TMP��TMD���[\._PR_DTSE ��._PR_DTSE
�w\CRTT

 �
[\._PR_DTSE � �._PR_DTSE��._PR_PKGAp\._PR_PDTS`��w`

 p\._PR_DTS1`��._PR_DTS2`p\._PR_DTS2`��._PR_DTS3`p\._PR_DTS3`��._PR_DTS4`p\._PR_DTS4`��w`

 �\ECONp\/_SB_PCI0LPCBEC0_CPUT`r�w`

 `p`PTMP���[�&TZ01PTMP�J_TMP��TMD���[\._PR_DTSE ��._PR_DTSE
�w\CRTT

 �
[\._PR_DTSE � �._PR_DTSE��._PR_PKGAp\._PR_PDTS`��w`

 p\._PR_DTS1`��._PR_DTS2`p\._PR_DTS2`��._PR_DTS3`p\._PR_DTS3`��._PR_DTS4`p\._PR_DTS4`��w`

 �\ECONp\/_SB_PCI0LPCBEC0_CPUT`r�``p`PTMP���MXPSL��TCNT
�C\._PR_CPU0\._PR_CPU1\._PR_CPU2\._PR_CPU3\._PR_CPU4\._PR_CPU5\._PR_CPU6\._PR_CPU7��TCNT
�*\._PR_CPU0\._PR_CPU1\._PR_CPU2\._PR_CPU3��TCNT
�\._PR_CPU0\._PR_CPU1�\._PR_CPU0HXPSV�[\._PR_APSV ��\._PR_APSV
��w\._PR_APSV

 ��w\PSVT

 XTC1�TC1VXTC2�TC2VXTSP�TSPVSSDTX �NOVOCB-01  ACPI  H\
 SSDTOCPU0IST ��� APIST �u� CPU0CST �u APCST � CPU0HWP :Wg�
 APHWP � HWPLVT �]g0 \PDC0 �\PDC1 �\PDC2 �\PDC3 �\PDC4 �\PDC5
 �\PDC6 �\PDC7 �\SDTL @\_PR_CTPC [�NVS  @i_k [�PNVSPGRVCFGD
 ACRTAPSVAAC0CPID
 CPPCCCTPCLVLCBMIPL10PL20PLW0CTC0TAR0PPC0PL11PL21PLW1CTC1TAR1PPC1PL12PL22PLW2CTC2TAR2PPC2C3MWC6MWC7MWCDMWC3LTC6LTC7LTCDLTCDLVCDPWMPMFDTSEDTS1DTS2DTSFPDTSPKGADTS3DTS4BGMA@BGMSBGIABGILDSIADSILDSAEEPCSEMNA@ELNG@HWPVHWPAHWPLPOWSHDCE[�O_D\._PR_DSIA\._PR_DSIL[�IO_DTRPD[�O_P\._PR_BGIA\._PR_BGIL[�IO_PTRPFI9\._PR_CPU0HI0_
 HC0_ HW0_ HW2_ _PDCpCPDCh`GCAP`�_OSCpCOSChijk`GCAP`�HCPDC� REVS�
SIZEp�`pt`
 a[h
@wa
 TEMPSTS0
 sSTS0TEMPb�OSC
�@)���Xq9SREVSSIZEb@COSC� STS0�
CAP0� IID0�
IID1�
IID2�
IID3UID0
�@)���Xq9S�ID0 EID0�ID0
EID1�ID0
EID2�ID0
EID3���IID0EID0�ID1EID1�IID2EID2�ID3EID3p
STS0���ip

STS0���STS0 �{CAP0 p \._PR_HDCE�[�MIP
�[�SMIPIOB2p
(IOB2�MGCAP� STS0�
CAP0��STS0
�TS0

��{STS0 {CAP0�P0�}{PDC0� CAP0PDC0�{CFGD
z ��{CFGD  {PDC0
 �SDTL
 }SDTL
SDTL[�ST0 �SSDT
 �SSDT
 [ CST0HC0_��CFGD �SDTL
 }SDTL
SDTL[�ST0 �SSDT �SSDT
 [ IST0HI0_��CFGD @ �SDTL
@ �{\._SB_OSCP
  }SDTL
@SDTL[�WP0 �SSDT
 �SSDT
 [ HWP0HW0_�{CFGD � [�WPL �SSDT
 �SSDT
 [ HWPLHW2_�{\._SB_OSCP
  ��\._SB_OSCP
@ p HWPV�{\._SB_OSCP
@ p
HWPV��PDC0  [�MIP
�[�SMIPIOB2p
'IOB2�G\._PR_CPU1HI1_ HC1_ HW1_
_PDCp\/_PR_CPU0CPDCh`GCAP`�"_OSCp\/_PR_CPU0COSChijk`GCAP`�B GCAP� STS1�
CAP1��STS1
�TS1

��{STS1 {CAP1�P1�}{PDC1� CAP1PDC1��PDC1

	APPT�{\._SB_OSCP
  HWPT�{PDC1
 APCTpPDC1PDC0�JAPCT ��CFGD
z �SDTL
  }SDTL
 SDTL[�ST1 �SSDT

 �SSDT
 [ CST1HC1_IAPPT ��CFGD �SDTL
 }SDTL
SDTL[�ST1 �SSDT
 �SSDT
 [ IST1HI1_MHWPT ��CFGD @ �SDTL
�}SDTL
�DTL[�WP1 �SSDT
 �SSDT
 [
HWP1HW1_C\._PR_CPU2_PDCp\/_PR_CPU0CPDCh`GCAP`�"_OSCp\/_PR_CPU0COSChijk`GCAP`�CGCAP�
STS2�
CAP2��STS2
�TS2

��{STS2 {CAP2�P2�}{PDC2� CAP2PDC2��PDC2

	\/_PR_CPU1APPT�{\._SB_OSCP
  \/_PR_CPU1HWPT�{PDC2

\/_PR_CPU1APCTpPDC2PDC0�C\._PR_CPU3_PDCp\/_PR_CPU0CPDCh`GCAP`�"_OSCp\/_PR_CPU0COSChijk`GCAP`�CGCAP�
STS3�
CAP3��STS3
�TS3

��{STS3 {CAP3�P3�}{PDC3� CAP3PDC3��PDC3

	\/_PR_CPU1APPT�{\._SB_OSCP
  \/_PR_CPU1HWPT�{PDC3

\/_PR_CPU1APCTpPDC3PDC0�C\._PR_CPU4_PDCp\/_PR_CPU0CPDCh`GCAP`�"_OSCp\/_PR_CPU0COSChijk`GCAP`�CGCAP�
STS4�
CAP4��STS4
�TS4

��{STS4 {CAP4�P4�}{PDC4� CAP4PDC4��PDC4

	\/_PR_CPU1APPT�{\._SB_OSCP
  \/_PR_CPU1HWPT�{PDC4

\/_PR_CPU1APCTpPDC4PDC0�C\._PR_CPU5_PDCp\/_PR_CPU0CPDCh`GCAP`�"_OSCp\/_PR_CPU0COSChijk`GCAP`�CGCAP�
STS5�
CAP5��STS5
�TS5

��{STS5 {CAP5�P5�}{PDC5� CAP5PDC5��PDC5

	\/_PR_CPU1APPT�{\._SB_OSCP
  \/_PR_CPU1HWPT�{PDC5

\/_PR_CPU1APCTpPDC5PDC0�C\._PR_CPU6_PDCp\/_PR_CPU0CPDCh`GCAP`�"_OSCp\/_PR_CPU0COSChijk`GCAP`�CGCAP�
STS6�
CAP6��STS6
�TS6

��{STS6 {CAP6�P6�}{PDC6� CAP6PDC6��PDC6

	\/_PR_CPU1APPT�{\._SB_OSCP
  \/_PR_CPU1HWPT�{PDC6

\/_PR_CPU1APCTpPDC6PDC0�C\._PR_CPU7_PDCp\/_PR_CPU0CPDCh`GCAP`�"_OSCp\/_PR_CPU0COSChijk`GCAP`�CGCAP�
STS7�
CAP7��STS7
�TS7

��{STS7 {CAP7�P7�}{PDC7� CAP7PDC7��PDC7

	\/_PR_CPU1APPT�{\._SB_OSCP
  \/_PR_CPU1HWPT�{PDC7
 \/_PR_CPU1APCTpPDC7PDC0�SSDTTC �nsydeNVOP  INTL
L\/_SB_PCI0PEG0PEGP[�BOR `�  [�VBORRVBS
VBS1�@VBS2�@VBS3�@VBS4�@VBS5�@VBS6�@VBS7�@VBS8�@C \/_SB_PCI0PEG0PEGP[�GOP ��
[�SGOPXBAS EBAS EECP DBPA SGGPSGMDPWOK HLRS DSEL ESEL PSEL PWEN PRST GBASAPDT
AHDT IHDT DSSV NVVD OPTFO\/_SB_PCI0PEG0PEGP[�OPR �w
[�NOPRDHPSDPCSGPSSVENSGC6SSLVSPBCMGPSPMXBS MXMB�SMXS
SMXB�KA\._SB_PCI0OTM_OTMACPI 2010-Mar-09 12:08:26 [�>WMI1_HIDPNP0C14
_UIDMXM2 _WDGH
��B�I�+ܩ:��b����i�� �:_�.�Oܼ��u>B��?�AS�$O�8�B�EWMMX�
FUNC��UNCMXMX�
XRG1��
�/_SB_PCI0GFX0MXMXXRG1��/_SB_PCI0PEG0PEGPMXMXXRG1���UNCMXDS�
XRG2��
�/_SB_PCI0GFX0MXDSXRG2��/_SB_PCI0PEG0PEGPMXDSXRG2�WQXMA*�FOMB �  DS
}�҃ B����0( �&&@�
����%B������J��!�����#��h�L���`�� L�Ta4E�d@ȣ �Фؽ
��p(@�kr![�hP��,*�P�����������i4�&8v�� }n9���x+��x׀��Ap�z�N༎��cgu2]��
.����l��A�̐���� x4�f�`P9J��%���zFE#k">xܖB �;�q��
���<`�>$����X0z�+ !��@��rlhx~p��M�89�������
��:���7j�|,�C��:�BD�!�'F1l����>4�tP�:������x�OP�O��|:�|:�`O�t�O��1^����=+��������5���c�����
���?���BZ\/_SB_PCI0PEG0LTRE [�PCX \/_SB_PCI0PEG0PEGPDBPA
[�RPCXPVIDPDID @T CMLW ASPM LNKDRTLK B LREN E( VCNP N| LNKS �
PCFG TREN � PRB1 @ PRB2 @ PRB3 @ PRB4 @ PRB5 @ PRB6 @
PRB7 @ PRB8 � AFES J PBSQ Li LREV=RBP0pr\/_SB_PCI0PEG0PEGPDBPAh
g[�CI0 g[�PCI0TEMP�EMPDWBP0pr\/_SB_PCI0PEG0PEGPDBPAh g[�CI0
g[�PCI0TEMPpiTEMP�EMPKBSPRprr\/_SB_PCI0PEG0PEGPDBPA wh
  g[�CI0 g
[�PCI0 TEMPpiTEMPOC7OK[�WHB \/_SB_PCI0PEG0PEGPXBAS [�MWHB @$MHEN
MHBR[�BAR ryMHBR
  P  [�MBAR � C7ADphC7ADWKEN [�EGB \/_SB_PCI0PEG0PEGPDBPA [�PEGB
PCMR H?PMST[�GRS \/_SB_PCI0PEG0PEGPEBAS
P[�DGRSDVID @SSSV [�'PG00 _STAMSD3 @_ON_��SD3
��/_SB_PCI0PEG0PEGPTDGC��/_SB_PCI0PEG0PEGPDGCX
p_STA\/_SB_PCI0PEG0PEGPGC6O���/_SB_PCI0PEG0PEGPDGCX
p_STA\/_SB_PCI0PEG0PEGPGC6Op \/_SB_PCI0PEG0PEGPTDGCp
\/_SB_PCI0PEG0PEGPDGCX�\/_SB_PCI0PEG0PEGPHGONp
PCMRp PMSTp�8SSSVp \/_SB_PCI0PEG0PEGPMLTFp_STAp MSD3p
\/_SB_PCI0LPCBEC0_GATY["

p \/_SB_PCI0PEG0PEGPMLTFI_OFF��SD3 p \/_SB_PCI0PEG0PEGPMLTFp
\/_SB_PCI0LPCBEC0_GATY["

��/_SB_PCI0PEG0PEGPTDGC[\/_SB_PCI0PEG0PEGPTGPC
GUPC��GUPC \/_SB_PCI0PEG0PEGPGC6Ip _STA���GUPC
\/_SB_PCI0PEG0PEGPGC6Ip _STA�\/_SB_PCI0PEG0PEGPHGOFp _STAp
MSD3_PR0PG00_PR2PG00_PR3PG00_PS0_PS3_S0W �{\._SB_OSCO
 ���$_DSW�ip WKEN���jpWKEN�p WKENA�/_SB_PCI0PEG0PEGPONOFIVID�CNT LDLY
dELCT FBDL MBDL CBDL HSTR UULN INDX POFF PLEN PDAT WLSB WMSB DMLW
DAT0AO�            $  (  ,  0  , @  D  H  L  P  L `
 d  h  l  p  l � � � � � � � � � � � � � � � � � � � � �
� � � 0
 
 
 
 � � � � � � � � � � � � � � � � � � � � � � � � 
 
 
 

 $
 (
 ,
 0
 4
 8
 <
 @
 D
 H
 L
 P
 T
 X
 \
 `
 d
 h
 l
 p
 t
 x
 |
 � � � � � � � �   8  X  x  � � � � $ � ` ( 8     
         "  $  &  (  ,  <  =  >  � � � � � � � � �
� � � � �  D P X \ �    ( , 8 @ D P X \ �
4 � � � � � � � � � � ��DAT1G
C ���������������[�GAR \/_SB_PCI0PEG0PEGPEBAS [�VGARVREG@�VGAB 
[�PIOGBAS
`[�GPIO @LVL0 @LVL1 @LVL2 [�CAP\/_SB_PCI0PEG0PEGPEECP
[�PCAP @ EMLW LCTL_INI p \/_SB_PCI0PEG0PEGP_ADR$GMXB pPCFGHSTR��STR
p
`�p
`�GPUAB p FBDLp CBDLpPCFGHSTR��STR
p FBDLp
CBDL���REV p FBDLp
CBDL�p
FBDLp
CBDLpINDX��CBDL ��INDXCBDLBSPRFBDL uFBDLuINDXHPDUBp FBDLphCBDL��BDL ���STR
��REV pt
CBDL FBDL�p FBDL���REV pt
CBDL FBDL�p
FBDLpINDX��INDXCBDLBSPRFBDLuFBDLuINDXH SPP0 p INDX�p�DAT0INDX
WLSBuINDXp�DAT0INDX WMSBuINDXp}yWMSB
 WLSB POFFp�DAT0INDX PLENuINDX��OFF�)�LEN pRBP0POFF�AT0INDX uINDXuPOFFvPLENH
RPP0 p INDX�p�DAT0INDX WLSBuINDXp�DAT0INDX WMSBuINDXp}yWMSB
 WLSB POFFp�DAT0INDX PLENuINDX��OFF�)�LEN WBP0POFF�DAT0INDX uINDXuPOFFvPLENH
CLP0 p INDX�p�DAT1INDX WLSBuINDXp�DAT1INDX WMSBuINDXp}yWMSB
 WLSB POFFp�DAT1INDX PLENuINDX��OFF�)�LEN WBP0POFF�DAT1INDX
uINDXuPOFFvPLENHHGON��CHK �pONOFSGPOHLRSSGPOPWEN["
SGPOHLRS ["
p AFESp PBSQp PRB1p PRB2p PRB3p PRB4p PRB5p PRB6p PRB7p PRB8p
LNKDpTREN��/_SB_PCI0PEG0LNKS
p
 `�`��/_SB_PCI0PEG0LNKS
[!
dv`��� p\/_SB_PCI0PEG0RTLK[!
dp\/_SB_PCI0PEG0LREN}{ELCT
C {LCTL� LCTLp \/_SB_PCI0PEG0PEGPMLTF�H_ON_��CHK �HGON��GPRFpVGABVREGp
\/_SB_PCI0LPCBEC0_GATY["

�E
HGOF��CHK �p ONOFpLCTLELCTpLNKDp TCNT��CNTLDLY��NKS �"
rTCNT
TCNTpPBSQp
AFESpPRB1pPRB2pPRB3pPRB4pPRB5pPRB6pPRB7pPRB8SGPOHLRSSGPOPWEN ["
2�G_OFF��CHK �p \/_SB_PCI0LPCBEC0_GATY["

��GPRFpVREGVGABHGOF�EPONpONOF� _STA�_DOD �0s�ASGPI �{SGMD
 ��GGPzh
`{h�aGGIVapGGIVab�� �b�b �<SGPO
�{SGMD
 ��GGPzh
`{h�a�� �i�[SGOV SGOVaiECCHK��/_SB_PCI0PEG0PVIDIVID��� ��NOF
������NOF��D#\/_SB_PCI0GFX0M_INI pDID1�LPK pDID2�LPK
 pDID3�LPK
 pDID4�LPK
 pDID5�LPK
 pDID6�LPK

 pDID7�LPK
 pDID2�LPK
 pDID1�LPK
 pDID2�LPK
 pDID3�LPK
 pDID2�LPK
 pDID4�LPK
 pDID2�LPK
 pDID5�LPK
 pDID2�LPK
 pDID6�LPK
 pDID2�LPK
 pDID7�LPK
 LMXMX �� \/_SB_PCI0PEG0PEGPSGPO\/_SB_PCI0PEG0PEGPESEL ������
�\/_SB_PCI0PEG0PEGPSGPI\/_SB_PCI0PEG0PEGPESEL�BMXDS ��
�\/_SB_PCI0PEG0PEGPSGPI\/_SB_PCI0PEG0PEGPDSEL��\/_SB_PCI0PEG0PEGPSGPO\/_SB_PCI0PEG0PEGPDSEL
�TLPK/ �
,�
,�
,�������I>\/_SB_PCI0PEG0PEGPGESC M<GPS__T_1 _T_0 ��i � �E:p�
_T_0��T_0 �
  �8� �T_0
 �
NRIT�
RITS[k

PSTS�
NPSS�
PSESGB32
 �B32 SPLU�B32PSLS�B32
CITS�B32
PSER�RITS�NRITpCITS�p CITSpCITSpPSER�GESCpSPLU�B32�.��T_0
!�/_PR_CPU0_PSS�,��T_0
"� NPPCpNPPC\._PR_CPPC��CNT
�._PR_CPU0
�\._PR_CPU1
�\._PR_CPU2
�\._PR_CPU3
�\._PR_CPU4
�\._PR_CPU5
�\._PR_CPU6
�\._PR_CPU7
�<�CNT
�._PR_CPU0
�\._PR_CPU1
�\._PR_CPU2
�\._PR_CPU3
�"�CNT
�._PR_CPU0
�\._PR_CPU1
��._PR_CPU0
� ���T_0
#�/_PR_CPU0_PPC���T_0
*� QUTP�
GPUT�
	CPUT�

FANS�
SKIN�
CENG�
SEN1�
SEN2GB42
$ �B42 STSV�B42
VERS�B42
TGPU�B42
PDTS�B42
SFAN�B42
SKNT�B42
CPUE�B42
TMP1�B42
 TMP2�p�UTP _T_1��T_1 �CPUTp
 STSV}STSVQUTPSTSVp\/_SB_PCI0LPCBEC0_CPUTPDTS�B42���T_1p
 STSV}STSVQUTPSTSVp�DTS�B42���T_1
}STSVQUTPSTSV�GPUT}STSV STSVp VERSp TGPUp PDTSp SFANp SKNTp CPUEp TMP1p
TMP2�B42�� �� �Jj\/_SB_PCI0GFX0FCSSNR _T_0 �Bp� _T_0��T_0 SBHS
�BHS VERV�BHS
NUMSp  VERVp
NUMS�BHS�=��T_0SCPP
L�CPP VRV1�CPP
VCAP�CPP
VCCP�CPP
VCDP�CPP
VCEP�CPP
VCGP�CPP
VCHP�CPP
VCXP�CPP
 VCYP�CPP
$VCZP�CPP
(VCKP�CPP
,VCMP�CPP
0VCNP�CPP
4VCAL�CPP
8VCBE�CPP
<VCGA�CPP
@VCPP�CPP
DVCDEp 
VRV1p�CAPpXVCCPpXVCDPpXVCEPp�VCGPpVCHPp6VCXPpVCYPp�VCZPpVCKPpVCMPpVCNPpkVCALp<VCBEp
VCGAp VCPPpVCDE�CPP�'��T_0
SGPP
(�GPP VRV2�GPP
VGWP�GPP
VGPP�GPP
VGQP�GPP
VGRP�GPP
VGAP�GPP
VGBP�GPP
VGCP�GPP
 VGDP�GPP
$VGDEp  VRV2p�GWPp�GPPp�GQPp�GRPpVGAPp�GBPpVGCPpVGDPp VGDE�GPP���T_0
SSCP
,�SCP
CSNT�SCP
CPTI�SCP
CICA�SCP
CIRC�SCP
CICV�SCP
CIRA�SCP
CIAV�SCP
 CIEP�SCP
$CPPF�SCP
(CSNRSSGP
,�SGP
GSNT�SGP
GPTI�SGP
GICA�SGP
GIRC�SGP
GICV�SGP
GIRA�SGP
GIAV�SGP
 GIEP�SGP
$GPPF�SGP
(GSNRp �SCP p CSNTpCPTIp
�ICAp CIRCp�CVp
CIRAp �IAVp
CIEPp
CPPFp
CSNRp�SGP p GSNTpGPTIp
�ICAp GIRCp�CVp
GIRAp �IAVp
GIEPp
GPPFp
GSNR�SSCPSSGP � �VSTSTBUD�PSCP M$SPB__T_0 ��i� �K"p� _T_0��T_0 �
  � ��T_0
 pTBUDa{a�a�[\/_SB_PCI0PEG0PEGPPBCM`�\/_SB_PCI0PEG0PEGPPBCM��VSTS }a
 @a����T_0
!�/_PR_CPU0_PSS���T_0
"MCHH � PCAPpPCAPPSCP��PCAP\/_PR_CPU0_PPC��/_PR_CPU0_PPC pMMCHMCHHpMMCH���CAP
pMCHHMMCHpPCAP\._PR_CPPC�._PR_CPU0
�4[\/_PR_CPU1_PPC`pPCAP\/_PR_CPU1_PPC�._PR_CPU1
�4[\/_PR_CPU2_PPC`pPCAP\/_PR_CPU2_PPC�._PR_CPU2
�4[\/_PR_CPU3_PPC`pPCAP\/_PR_CPU3_PPC�._PR_CPU3
�PCAP���T_0
#�SCP���T_0
$[k
THBG[k
DDVE�/_SB_PCI0PEG0PEGPPBCM���T_0
*�SNRk� �D`\/_SB_PCI0PEG0PEGPTGPC
 TDGC DGCX TRPC AGC6Ip \/_SB_PCI0LPCBEC0_GATY["

p\/_SB_PCI0PEG0LREN\/_SB_PCI0PEG0LTREpLNKD��GPI  ["LGC6OSGPO  p
LNKD��NKS
["SGPO  p\/_SB_PCI0PEG0LTRE\/_SB_PCI0PEG0LREN["
p MLTFp
\/_SB_PCI0LPCBEC0_GATY["

GETS��GPI  ���HMOGC6_T_0 ��i  � �EKp� _T_0��T_0 �
 �I��T_0JTB1
 [JTB1 JTEN[JTB1
SREN[JTB1

PLPR[JTB1

FBPR[JTB1

GUPR[JTB1

GC6R[JTB1
PTRH��OSYS�[JTB1
MHYB[JTB1
RPCL[JTB1

GC6V[JTB1

JTRVpJTENpGC6R��OSYS�pMHYBpRPCL��RPCL
pTRPCpGC6VpPTRHpSRENpJTRV�TB1�9��T_0
� �O7��T_0
[k
GUPC[k
PLPC[k
ECOC��OSYS�[k

DFGC[k

GPCXpkTGPC���GUPC ��FGC p�FGC \/_SB_PCI0PEG0PEGPTDGCp�PCX
\/_SB_PCI0PEG0PEGPDGCXJTB3
 [JTB3
GUPS[JTB3
GPGS[JTB3
PLST��OSYS����FGC pGPGSpGUPS�TB3��GUPC GC6IpPLSTp GUPS���GUPC
GC6I��PLPC p PLSTpGPGSp GUPS���GUPC
GC6O���LPC p PLSTpGPGSp GUPS���GUPC
pkTGPCGC6O���LPC p PLST���GUPC pGETSGUPS��GUPS pGPGS�p GPGS�TB3���T_0
� �N��T_0
[k
ATCD[k

ACTD[k
DMSK[k

NCSN[k
NCRT[k
NCSMJTB5
 [JTB5
DPAE[JTB5
LIDE[JTB5
DOCS[JTB5

TLSN[JTB5
DHPS[JTB5

DHPE���CSM p�CSN TLSN���MSK GETD�TCD �CTD p\/_SB_PCI0PEG0PEGPNTOITLSNpDPAE�TB5�
� �T_0
TMP6�
,����DID2�MP6 pDID1�MP6
 pDID4�MP6
 pDID2�MP6
 pDID1�MP6
 pDID2�MP6
	 pDID4�MP6

 pDID1�MP6
 pDID4�MP6
 �MP6� ��\/_SB_PCI0PEG0PEGP\/_SB_PCI0PEG0PEGPGACD \/_SB_PCI0PEG0PEGPGATD
 [�CNV \/_SB_PCI0PEG0PEGPEBAS [�PCNV �  MLTFOMPR
DGOS CTOINTOIMADL MSTE GPRF KrVSTS ��\/_SB_PCI0GFX0CPDL
��/_SB_PCI0GFX0CPDL{DID1�GATD
GATD���/_SB_PCI0GFX0CPDL{DID2�GATDGATD��\/_SB_PCI0GFX0CPL2
��/_SB_PCI0GFX0CPL2{DID1�GATD
GATD���/_SB_PCI0GFX0CPL2{DID2�GATDGATD��\/_SB_PCI0GFX0CPL3
��/_SB_PCI0GFX0CPL3{DID1�GATD
GATD���/_SB_PCI0GFX0CPL3{DID2�GATDGATD��\/_SB_PCI0GFX0CPL4
��/_SB_PCI0GFX0CPL4{DID1�GATD
GATD���/_SB_PCI0GFX0CPL4{DID2�GATDGATD��\/_SB_PCI0GFX0CPL5
��/_SB_PCI0GFX0CPL5{DID1�GATD
GATD���/_SB_PCI0GFX0CPL5{DID2�GATDGATD��\/_SB_PCI0GFX0CPL6
��/_SB_PCI0GFX0CPL6{DID1�GATD
GATD���/_SB_PCI0GFX0CPL6{DID2�GATDGATD��\/_SB_PCI0GFX0CPL7
��/_SB_PCI0GFX0CPL7{DID1�GATD
GATD���/_SB_PCI0GFX0CPL7{DID2�GATDGATD��\/_SB_PCI0GFX0CPL8
��/_SB_PCI0GFX0CPL8{DID1�GATD
GATD���/_SB_PCI0GFX0CPL8{DID2�GATDGATD��\/_SB_PCI0GFX0CADL
��/_SB_PCI0GFX0CADL{DID1�GACD
GACD���/_SB_PCI0GFX0CADL{DID2�GACDGACD��\/_SB_PCI0GFX0CAL2
��/_SB_PCI0GFX0CAL2{DID1�GACD
GACD���/_SB_PCI0GFX0CAL2{DID2�GACDGACD��\/_SB_PCI0GFX0CAL3
��/_SB_PCI0GFX0CAL3{DID1�GACD
GACD���/_SB_PCI0GFX0CAL3{DID2�GACDGACD��\/_SB_PCI0GFX0CAL4
��/_SB_PCI0GFX0CAL4{DID1�GACD
GACD���/_SB_PCI0GFX0CAL4{DID2�GACDGACD��\/_SB_PCI0GFX0CAL5
��/_SB_PCI0GFX0CAL5{DID1�GACD
GACD���/_SB_PCI0GFX0CAL5{DID2�GACDGACD��\/_SB_PCI0GFX0CAL6
��/_SB_PCI0GFX0CAL6{DID1�GACD
GACD���/_SB_PCI0GFX0CAL6{DID2�GACDGACD��\/_SB_PCI0GFX0CAL7
��/_SB_PCI0GFX0CAL7{DID1�GACD
GACD���/_SB_PCI0GFX0CAL7{DID2�GACDGACD��\/_SB_PCI0GFX0CAL8
��/_SB_PCI0GFX0CAL8{DID1�GACD
GACD���/_SB_PCI0GFX0CAL8{DID2�GACDGACDpGATD\/_SB_PCI0PEG0PEGPMADLpGACD\/_SB_PCI0PEG0PEGPMSTEp
GATDp GACDKlGETD
_T_5 _T_4 _T_3 _T_2 _T_1 _T_0
VSTS}\/_SB_PCI0PEG0PEGPMADLh\/_SB_PCI0PEG0PEGPMADL}\/_SB_PCI0PEG0PEGPMSTEi\/_SB_PCI0PEG0PEGPMSTE�cp�/_SB_PCI0PEG0PEGPMADL
_T_0��T_0
�p�/_SB_PCI0PEG0PEGPMSTE _T_1��T_1p\/_SB_PCI0PEG0PEGPCTOIp
\/_SB_PCI0PEG0PEGPNTOI���T_1
p
\/_SB_PCI0PEG0PEGPCTOIp
\/_SB_PCI0PEG0PEGPNTOI���T_1
p
\/_SB_PCI0PEG0PEGPCTOIp
\/_SB_PCI0PEG0PEGPNTOI���T_1
p
\/_SB_PCI0PEG0PEGPCTOIp
\/_SB_PCI0PEG0PEGPNTOI���T_1
p
\/_SB_PCI0PEG0PEGPCTOIp
\/_SB_PCI0PEG0PEGPNTOI���T_1
p
\/_SB_PCI0PEG0PEGPCTOIp\/_SB_PCI0PEG0PEGPNTOI�p\/_SB_PCI0PEG0PEGPCTOIp\/_SB_PCI0PEG0PEGPNTOI�MC��T_0
�p�/_SB_PCI0PEG0PEGPMSTE _T_2��T_2
p
\/_SB_PCI0PEG0PEGPCTOIp
\/_SB_PCI0PEG0PEGPNTOI���T_2
p
\/_SB_PCI0PEG0PEGPCTOIp
\/_SB_PCI0PEG0PEGPNTOI���T_2
p
\/_SB_PCI0PEG0PEGPCTOIp
\/_SB_PCI0PEG0PEGPNTOI�p
\/_SB_PCI0PEG0PEGPCTOIp
\/_SB_PCI0PEG0PEGPNTOI�J1��T_0
�p�/_SB_PCI0PEG0PEGPMSTE _T_3��T_3p\/_SB_PCI0PEG0PEGPCTOIp
\/_SB_PCI0PEG0PEGPNTOI���T_3
p
\/_SB_PCI0PEG0PEGPCTOIp
\/_SB_PCI0PEG0PEGPNTOI���T_3
p
\/_SB_PCI0PEG0PEGPCTOIp\/_SB_PCI0PEG0PEGPNTOI�p\/_SB_PCI0PEG0PEGPCTOIp\/_SB_PCI0PEG0PEGPNTOI�L��T_0
�p�/_SB_PCI0PEG0PEGPMSTE _T_4��T_4p\/_SB_PCI0PEG0PEGPCTOIp
\/_SB_PCI0PEG0PEGPNTOI���T_4
p
\/_SB_PCI0PEG0PEGPCTOIp
\/_SB_PCI0PEG0PEGPNTOI���T_4
p
\/_SB_PCI0PEG0PEGPCTOIp\/_SB_PCI0PEG0PEGPNTOI�p\/_SB_PCI0PEG0PEGPCTOIp\/_SB_PCI0PEG0PEGPNTOI�N�p�/_SB_PCI0PEG0PEGPMSTE
_T_5��T_5p\/_SB_PCI0PEG0PEGPCTOIp\/_SB_PCI0PEG0PEGPNTOI���T_5
p
\/_SB_PCI0PEG0PEGPCTOIp
\/_SB_PCI0PEG0PEGPNTOI���T_5
p
\/_SB_PCI0PEG0PEGPCTOIp
\/_SB_PCI0PEG0PEGPNTOI�F9NVOP_T_0 ��i � �J7p� _T_0��T_0
��\/_SB_PCI0PEG0PEGPDHPS p
a `�p
a `��3��T_0
TMP5
 [TMP5
DAVF[TMP5
LIDF[TMP5

TOGN[k
NCSM[k

NCSN[k
DIMK[k

ACTD[k
ATTD��CSM p�CSN TOGN���IMK GETD�TTD �CTD
p\/_SB_PCI0PEG0PEGPNTOITOGNpDAVF�MP5�&� �T_0
TMP6�
,����DID2�MP6 pDID1�MP6
 pDID4�MP6
 pDID2�MP6
 pDID1�MP6
 pDID2�MP6
	 pDID4�MP6

 pDID1�MP6
 pDID4�MP6
 �MP6���T_0
�/_SB_PCI0PEG0PEGPGOBTk���T_0
[k

OPCE[k FLCH[kDVSR[k
DVSC��LCH p�PCE OMPRRBUF
 [RBUF OPEN[RBUF

CGCS[RBUF
SHPC[RBUF
SNSR[RBUF

DGPC[RBUF

HDACpOPEN��\/_SB_PCI0PEG0PEGPDHPS pSHPCpHDAC��\/_SB_PCI0PEG0PEGPDPCS
pDGPC��VSC ��VSR pGPRF�p GPRFpGPRFSNSR�\/_SB_PCI0PEG0PEGPGSTAp
CGCS�p CGCS�p
CGCS�BUF���T_0
pk`[` OPFL[`OPVL��PVL p OPTF��PFL pOPTFpOPTF`��� �LGOBTOPVKF
� �
USRG��SRGKV�PVK�GSTA��GPIPWOK���J_PS0 �DGOS��\/_SB_PCI0PEG0PEGPDPCS
\/_SB_PCI0PEG0PEGP_ON_p DGOS��\/_SB_PCI0PEG0PEGPDHPS p MLTFH_PS3
��/_SB_PCI0PEG0PEGPOMPR
��\/_SB_PCI0PEG0PEGPDPCS \/_SB_PCI0PEG0PEGP_OFFpDGOSp
\/_SB_PCI0PEG0PEGPOMPRC_ROM
_T_0 ph`piaVROMa �� p a��RVBS�ROMrhib��RVBStRVBS`ax` �d�pd_T_0��T_0
p\/_SB_PCI0PEG0PEGPVBS1e���T_0p\/_SB_PCI0PEG0PEGPVBS2e���T_0
p\/_SB_PCI0PEG0PEGPVBS3e���T_0
p\/_SB_PCI0PEG0PEGPVBS4e� ��T_0
p\/_SB_PCI0PEG0PEGPVBS5e���T_0
p\/_SB_PCI0PEG0PEGPVBS6e���T_0
p\/_SB_PCI0PEG0PEGPVBS7e���T_0
p\/_SB_PCI0PEG0PEGPVBS8e� �dt`d`�`aVROM�ROMMMXMX ��
\/_SB_PCI0PEG0PEGPSGPOESELP8XH
�8XH ���P8XH
�8XH ���
P8XH
�8XH
�/_SB_PCI0PEG0PEGPSGPIESEL�KMXDS ��
�/_SB_PCI0PEG0PEGPSGPIDSEL��\/_SB_PCI0PEG0PEGPSGPODSEL�M_DSM_T_0 ��
Q��$I�� �4��\/_SB_PCI0PEG0PEGPGC6S �/_SB_PCI0PEG0PEGPOGC6hijk��
�
�B�p����\/_SB_PCI0PEG0PEGPVENS �/_SB_PCI0GFX0SPB_hijk��
-��I��F��7�\/_SB_PCI0PEG0PEGPGPSS �/_SB_PCI0PEG0PEGPGPS_hijk��
��G�`B���/_SB_PCI0PEG0PEGPNVOPhijk��
 �@}�L�y��e�p� _T_0��T_0 �
 ���T_0
�
0 ���T_0
�� ��MXBS MXM3MXBS pMXMBMXM3�XM3� � �MAR� �ENOVOCB-01  ACPI  &  �
   �  �   �u �    z �   FPDTD �ENOVOCB-01  ACPI   �   �
BGRT8 LENOVOCB-01  ACPI   �f @ � XSDT� 
LENOVOCB-01    � �w �w �w P� @� 0� � � � � �w �w �w �w �w �w �w �w 0� � � �

Sun Oct 17 13:07:35 EDT 2021
RSDT� lLENOVOCB-01    � �w �w �w P�������������������CP�LENOVOCB-01  ACPI 
�w �w  � ��  P  �   e 9  2 �  � � �w         P 
  �  DSDTD� �ENOVOCB-01  ACPI  SS1_ SS2_ SS3_SS4_[�NVS
��[�0GNVSOSYSSMIFPRM0PRM1SCIFPRM2PRM3LCKFPRM4PRM5P80D
PWRSDBGSTHOFACT1ACTTPSVTTC1VTC2VTSPVCRTTDTSEDTS1DTS2DTSF      
 REVNAPICTCNTPCP0PCP1PPCMPPMF
C67LNATPCMAPCMBPLPTPFDCPCMCPCIRPSMSCW381SMC1EMAEEMAPEMALMEFEDSTSMORDTCGPPPRP
PPRQLPPRIDEMBID_PLIDBTYPOSCCNEXPSBV1SBV2
DSENGPICCTYPL01CVFN0VFN1VFN2VFN3VFN4VFN5VFN6VFN7VFN8VFN9ATMCPTMCPNHM
TBAL TBAH
RTIPTSODPFLVBREVBBIDPDTSPKGAPAMTAC0FAC1FDTS3DTS4LTR1LTR2LTR3LTR4LTR5LTR6LTR7LTR8LTR9LTRALTRBLTRCLTRDLTRELTRFLTRGLTRHLTRILTRJLTRKOBF1OBF2OBF3OBF4OBF5OBF6OBF7OBF8OBF9OBFAOBFBOBFCOBFDOBFEOBFFOBFGOBFHOBFIOBFJOBFKXTUB
XTUS XMPB
DDRFRTD3PEP0PEP3DPTFSADESACRSAHTCTDPLPMPLPMVECEUTGFGMEMDATRAPTRAMEMCMEMHFND1FND2AMBDAMATAMPTAMCTAMHTSKDESKATSKPTSKCTSKHTEFDEEFATEFPTEFCTEFHTVRDEVRATVRPTVRCTVRHTDPAPDPPPDPCPDCMPTRTVLPOELPOPLPOSLPOWLPERPPSZ
DISEBGMA@BGMSBGIAIRMCNFCECHENS0IDCTDBDKSMSIO1SIO2SPBASEC0 SEC1 SEC2
SEC3 SEC4 SEC5 SEC6 SEC7 SEC8 @iWIFDWFATWFPTWFCTWFHTPWREPWRP
@XHPRRIC0DVS0DVS1DVS2DVS3GBSXIUBEIUCEIUDEECNOAUDDIC0DIC1DIC1SVRRDPSCPI20DI21DRCG0ECDBP2MESSH0SSL0SSD0FMH0FML0FMD0FPH0FPL0FPD0SSH1SSL1SSD1FMH1FML1FMD1FPH1FPL1FPD1M0C0M1C0M2C0M0C1M1C1M2C1M0C2M1C2M0C3M1C3M0C4M1C4M0C5M1C5TBSFGIRQ
DMTPDMTDDMSHLANPSHSBPLCSPLVLGN1EG1ATG1PTG1CTG1HTGN2EG2ATG2PTG2CTG2HTWWSDCVSDSSDDINLDIFATIFPTIFCTIFHTSDWEUSBHBCV4WTV0WTV1APFUSOHPGP5FNOHPTBSEWKFNPEPC
VRSDPB1EGNIDWANDWWATWWPTWWCTWWHT
HMPL0CHGESAC3MEM3AMC3SKC3EFC3VRC3WFC3G1C3G2C3IFC3WWC3WGC3SPSTPERE
GN3EG3ATG3PTG3CTG3HTGN4EG4ATG4PTG4CTG4HTGN5EG5ATG5PTG5CTG5HTGN6EG6ATG6PTG6CTG6HTECLPG3C3G4C3G5C3G6C3TSP1TSP2TSP3TSP4TSP5TSP6TSP7TSP8SSP1SSP2SSP3SSP4SSP5SSP6SSP7SSP8MEMS
HS1DES1ATS1PTS1CTS1HTS2DES2ATS2PTS2CTS2HTS3DES3ATS3PTS3CTS3HTS4DES4ATS4PTS4CTS4HTS5DES5ATS5PTS5CTS5HTS6DES6ATS6PTS6CTS6HTS7DES7ATS7PTS7CTS7HTS1S3S2S3S3S3S4S3S5S3S6S3S7S3PSMEPDT1PLM1PTW1PDT2PLM2PTW2DDT1DDP1DLI1DPL1DTW1DMI1DMA1DMT1DDT2DDP2DLI2DPL2DTW2DMI2DMA2DMT2WIFEDOM1LIM1TIM1DOM2LIM2TIM2DOM3LIM3TIM3TRD0TRL0TRD1TRL1WDM1CID1WDM2CID2
APPEMPL1MPL2SDS0SDS1SDS2SDS3SDS4SDS5SDS6SDS7SDS8SDS9SDSATPLBTPLHWTVXWITXGPTDGDBTUTKXSPTDGEXNTBTSAICSTARSFPATFPENFPGN
FPLVCPADCPABTNATCPGN CF2TATLB
SDM0SDM1SDM2SDM3SDM4SDM5SDM6SDM7SDM8SDM9SDMAUSTPSSHISSLISSDIFMHIFMLIFMDIFPHIFPLIFPDIM0CIM1CIM0CSM1CSM0CUM1CUCAMTDS4DIVDFEIDFGFPS
GFPI GNSMGNSCGGNR GBTW GBTK GBTI GPDI GPLI
CL00CL01CL02CL03L0ENL1ENL2ENL3ENCDIVC0TPC0CVC0GPC0IBC0IAC0P0C0P1C0P2C0P3C0G0C0G1C0G2C0G3C0F0C0F1C0F2C0F3C0A0C0A1C0A2C0A3C0I0C0I1C0I2C0I3C0PLC1TPC1CVC1GPC1IBC1IAC1P0C1P1C1P2C1P3C1G0C1G1C1G2C1G3C1F0C1F1C1F2C1F3C1A0C1A1C1A2C1A3C1I0C1I1C1I2C1I3C1PLC2TPC2CVC2GPC2IBC2IAC2P0C2P1C2P2C2P3C2G0C2G1C2G2C2G3C2F0C2F1C2F2C2F3C2A0C2A1C2A2C2A3C2I0C2I1C2I2C2I3C2PLC3TPC3CVC3GPC3IBC3IAC3P0C3P1C3P2C3P3C3G0C3G1C3G2C3G3C3F0C3F1C3F2C3F3C3A0C3A1C3A2C3A3C3I0C3I1C3I2C3I3C3PLL0SML0H0L0H1L0H2L0H3L0H4L0H5L0H6L0H7L0H8L0PLL0M0L0M1L0M2L0M3L0M4L0M5L0M6L0M7L0M8L0M9L0MAL0MBL0MCL0MDL0MEL0MFL0DIL0BSL0A0L0A1L0A2L0A3L0A4L0A5L0A6L0A7L0A8L0A9L0AAL0ABL0D0L0D1L0D2L0D3L0D4L0D5L0D6L0D7L0D8L0D9L0DAL0DBL0DVL0CVL0LUL0NLL0EEL0VCL0FSL0DGL0C0L0C1L0C2L0C3L0CK
L0CLL1SML1H0L1H1L1H2L1H3L1H4L1H5L1H6L1H7L1H8L1PLL1M0L1M1L1M2L1M3L1M4L1M5L1M6L1M7L1M8L1M9L1MAL1MBL1MCL1MDL1MEL1MFL1DIL1BSL1A0L1A1L1A2L1A3L1A4L1A5L1A6L1A7L1A8L1A9L1AAL1ABL1D0L1D1L1D2L1D3L1D4L1D5L1D6L1D7L1D8L1D9L1DAL1DBL1DVL1CVL1LUL1NLL1EEL1VCL1FSL1DGL1C0L1C1L1C2L1C3L1CK
L1CLL2SML2H0L2H1L2H2L2H3L2H4L2H5L2H6L2H7L2H8L2PLL2M0L2M1L2M2L2M3L2M4L2M5L2M6L2M7L2M8L2M9L2MAL2MBL2MCL2MDL2MEL2MFL2DIL2BSL2A0L2A1L2A2L2A3L2A4L2A5L2A6L2A7L2A8L2A9L2AAL2ABL2D0L2D1L2D2L2D3L2D4L2D5L2D6L2D7L2D8L2D9L2DAL2DBL2DVL2CVL2LUL2NLL2EEL2VCL2FSL2DGL2C0L2C1L2C2L2C3L2CK
L2CLL3SML3H0L3H1L3H2L3H3L3H4L3H5L3H6L3H7L3H8L3PLL3M0L3M1L3M2L3M3L3M4L3M5L3M6L3M7L3M8L3M9L3MAL3MBL3MCL3MDL3MEL3MFL3DIL3BSL3A0L3A1L3A2L3A3L3A4L3A5L3A6L3A7L3A8L3A9L3AAL3ABL3D0L3D1L3D2L3D3L3D4L3D5L3D6L3D7L3D8L3D9L3DAL3DBL3DVL3CVL3LUL3NLL3EEL3VCL3FSL3DGL3C0L3C1L3C2L3C3L3CK
L3CLECR1 (I2SCODV0ODV1ODV2ODV3ODV4ODV5UBCB EMODWIFC
8TPLSTPDBTPDHTPDSAG1L@AG1H@AG2L@AG2H@AG3L@AG3H@HEFEXDCE
HCCMDCOMDLPT1PSTPWKMDIDERPIE0PIE1CSTSPMEEWOLENVAD NVSZ
S1C0S1C1S2C0S2C1P2KBHRAMMDENTBEPFGNETBTCTRPNTBTM [�GNS ��
[�OGNSOG00OG01OG02OG03OG04OG05OG06OG07OG08OG09OG10ECON�_SB_PR00O!�
LNKA �LNKB �
LNKC �
LNKD � LNKA �LNKB �
LNKC �
LNKD � LNKA �LNKB �
LNKC �
LNKD � LNKA �LNKB �
LNKC �
LNKD � LNKA � LNKA �LNKB �
LNKC �
LNKD � LNKA �LNKB �
LNKC �
LNKD � LNKA �LNKB �
LNKC �
LNKD � LNKA � LNKA � LNKA � LNKA AR00B#-�
�
�

�

�
�
�

�

�
�
�

�

�
�
�

�

�
�
�

�

�
 �
!�

"�
�
�
�

�

�
�
�

�

�
�
�

�

�
�
�
�

�

�
�
�
�
PR044�NKA �NKB �LNKC �LNKD AR04, �
 �

�

�
PR054�NKB �NKC �LNKD �LNKA AR05, �
 �

�

�
PR064�NKC �NKD �LNKA �LNKB AR06, �
 �

�

�
PR074�NKD �NKA �LNKB �LNKC AR07, �
 �

�

�
PR084�NKA �NKB �LNKC �LNKD AR08, �
 �

�

�
PR094�NKB �NKC �LNKD �LNKA AR09, �
 �

�

�
PR0E4�NKC �NKD �LNKA �LNKB AR0E, �
 �

�

�
PR0F4�NKD �NKA �LNKB �LNKC AR0F, �
 �

�

�
PR024�NKA �NKB �LNKC �LNKD AR02, �
 �

�

�
PR0A4�NKB �NKC �LNKD �LNKA AR0A, �
 �

�

�
PR0B4�NKC �NKD �LNKA �LNKB AR0B, �
 �

�

�
PRSA
#x�y
PRSAPRSBPRSAPRSCPRSAPRSDPRSAPRSEPRSAPRSFPRSAPRSGPRSAPRSH[��CI0_HIDA�_CIDA�_ADR
 ^BN00 �_BBN �N00_UID _PRT �PICM�R00�R00[�BUS  [�HBUS @ EPEN EPBR
MHEN MHBR GCLK D0END1F2D1F1D1F0 LPXENPXSZ PXBR DIEN DIBR MEBR
@PMLK PM0H PM1L PM1H PM2L PM2H PM3L PM3H PM4L PM4H PM5L
PM5H PM6L PM6H  H TUUD I TLUD @ HTSEBUF0A"�  � �  �
�G��  � � 
 �  �   � @ �  @ � @ �  � � @ �  � � @ �  � @ �  @ � @ �  � � @ �
  � � @ �   � @ �  @ � @ �  � � @ �  � � @ �   �  �  � �   �
  �  �� �y EP_B MH_B PC_B PC_L DM_B GEPB��P_B yEPBR
EP_B�P_BGMHB��H_B yMHBR
MH_B�H_BGPCB��C_B yPXBR
PC_B�C_B!GPCL��C_L z PXSZPC_L�C_LGDMB��M_B yDIBR
DM_B�M_B@7_CRSpGPCL`�UF0

PBMXptz`

 PBMX�UF0
PBLNptz`
  PBLN�PM1L�UF0
|C0LNp C0LN��M1L�UF0XC0RWp C0RW�PM1H�UF0
�4LNp C4LN��M1H�UF0(C4RWp C4RW�PM2L�UF0
�8LNp C8LN��M2L�UF0�RWp C8RW�PM2H�UF0
�CLNp CCLN��M2H�UF0�CCRWp CCRW�PM3L�UF0
�LNp D0LN��M3L�UF0�D0RWp D0RW�PM3H�UF0
�Np D4LN��M3H�UF0hD4RWp D4RW�PM4L�UF0D8LNp D8LN��M4L�UF08D8RWp
D8RW�PM4H�UF02DCLNp DCLN��M4H�UF0 DCRWp DCRW�PM5L�UF0LE0LNp
E0LN��M5L�UF0�E0RWp E0RW�PM5H�UF0fE4LNp E4LN��M5H�UF0�E4RWp
E4RW�PM6L�UF0�E8LNp E8LN��M6L�UF0xE8RWp E8RW�PM6H�UF0�ECLNp
ECLN��M6H�UF0HECRWp ECRW�PM0H�UF0�F0LNp F0LN��M0H�UF0F0RWp
F0RW�UF0�M1MN�UF0�M1MX�UF0�M1LNpM32LM1LNpM32BM1MNtrM1MNM1LN M1MX��64L
�UF0�LNp MSLN��UF0�LN�UF0�2MN�UF0�2MXpM64LM2LNpM64BM2MNtrM2MNM2LN
M2MX�UF0GUID
[M���tA��SUPP CTRL XCNT O_OSCpk`� CDW1�
CDW2�
CDW3� �hGUIDNEXPpCDW2SUPPpCDW3CTRL��TBTS�NAT{CTRL�CTRL��CDW1 �{CTRL
NHPG�{CTRL
 NPME��i}CDW1
CDW1��CDW3CTRL}CDW1
CDW1pCTRLCDW3pCTRLOSCC��}CDW1
CDW1�G\._SB_PCI0AR00 �^AR00PR00 �^PR00AR02 �^AR02PR02 �^PR02AR04
�^AR04PR04 �^PR04AR05 �^AR05PR05 �^PR05AR06 �^AR06PR06 �^PR06AR07
�^AR07PR07 �^PR07AR08 �^AR08PR08 �^PR08AR09 �^AR09PR09 �^PR09AR0A
�^AR0APR0A �^PR0AAR0B �^AR0BPR0B �^PR0B[�PEG0_ADR  [�PEGP_ADR [�PEG1_ADR
 [�PEGP_ADR [�PEG2_ADR  [�PEGP_ADR [�GFX0_ADR 
[�B0D4_DSM�PCICh�CIDhijk_ADR  ��CR1G._SB_PCI0PCIG
��S5zM���MBPCID��PCIG��i
�� �
��
���
	�P��� %._SB_PCI0PCIC ��CR1��PCIG��PNVB��NVL[�NVA
	PNVBPNVL[�>PNVARCRV PCHSPCHGRPA1 RPA2 RPA3 RPA4 RPA5 RPA6 RPA7 RPA8
	RPA9 RPAA RPAB RPAC RPAD RPAE RPAF RPAG RPAH RPAI RPAJ RPAK NHLA@NHLL
	ADFM SBRG GPEM G2L0 G2L1 G2L2 G2L3 G2L4 G2L5 G2L6 G2L7 G2L8 G2L9
	PML1PML2PML3PML4PML5PML6PML7PML8PML9PMLAPMLBPMLCPMLDPMLEPMLFPMLGPMLHPMLIPMLJPMLKPNL1PNL2PNL3PNL4PNL5PNL6PNL7PNL8PNL9PNLAPNLBPNLCPNLDPNLEPNLFPNLGPNLHPNLIPNLJPNLKU0C0
	U1C0 ADPM XHPCXRPCXSPCXSPAHPTB
	HPTESMD0SMD1SMD2SMD3SMD4SMD5SMD6SMD7SMD8SMD9SMDASIR0SIR1SIR2SIR3SIR4SIR5SIR6SIR7SIR8SIR9SIRASB00
	SB01 SB02 SB03 SB04 SB05 SB06 SB07 SB08 SB09 SB0A SB10 SB11 SB12 SB13 SB14
	SB15 SB16 SB17 SB18 SB19 SB1A
	GPENSGIRNIT1NIT2NIT3NPM1NPM2NPM3NPC1NPC2NPC3NL11NL12NL13ND21ND22ND23ND11
	ND12 ND13 NLR1NLR2NLR3NLD1 NLD2 NLD3
	NEA1NEA2NEA3NEB1NEB2NEB3NEC1NEC2NEC3NRA1NRA2NRA3NMB1 NMB2 NMB3
	NMV1 NMV2 NMV3 NPB1 NPB2 NPB3 NPV1 NPV2 NPV3 SXRB SXRS
	CIOECIOITAENTIRQXWMB
	EMH4CSKUITA0ITA1ITA2ITA3ITS0ITS1ITS2ITS3D�SB_GCOMC* �
	� � � � � � �4
 � � � � � � � � � �GPPG,


















PCFG> � �� � 
 � ����h  HOWN,
��������

�������
��POWN,

0

0
@

0
 


,

,
8
@
L
X

 GPEO>@D@DH@D@
@D@DHLPT@@GPES
 RXEV
���GNUMpGNMBhapGGRPhb�awb
 IINUM��CHS
p `�p`pGNMBhapGGRPhbp c��br��GPPG` c aauc�
�
` GGRP z{h �`�GNMB �h�;GGPEpGGRPh`pGNMBhap{zGPEMw`

 b�� �o��wtb
  a ;GADR��CHS
p `�p`pr��GCOM` h SBRG ap��i` h b�ab CGPC0 pGGRPh`pGNMBhaprGADR`PCFGwa
 b[�DW0 b
[�PDW0 TEMP �EMPDSPC0
pGGRPh`pGNMBhaprGADR`PCFGwa
 b[�DW0 b
[�PDW0 TEMP piTEMPGGPC1 pGGRPh`pGNMBhaprrGADR`PCFGwa

 b[�DW1 b
[�PDW1 TEMP �EMPHSPC1
pGGRPh`pGNMBhaprrGADR`PCFGwa

 b[�DW1 b
[�PDW1 TEMP piTEMPHSRXO
pGGRPh`pGNMBhaprGADR`PCFGwa
 b[�DW0 b
[�PDW0 TEMP piTEMPGGGIV pGGRPh`pGNMBhaprGADR`PCFGwa
 b[�DW0 b
[�PDW0 TEMP �EMPEGGOV pGGRPh`pGNMBhaprGADR`PCFGwa
 b[�DW0 b
[�PDW0 TEMP �EMPFSGOV
pGGRPh`pGNMBhaprGADR`PCFGwa
 b[�DW0 b
[�PDW0 TEMP piTEMPGGGII pGGRPh`pGNMBhaprGADR`PCFGwa
 b[�DW0 b
[�PDW0 TEMP �EMPHSGII
pGGRPh`pGNMBhaprGADR`PCFGwa
 b[�DW0 b
[�PDW0 TEMP piTEMPGGPMV pGGRPh`pGNMBhaprGADR`PCFGwa
 b[�DW0 b
[�PDW0
TEMP �EMPHSPMV
pGGRPh`pGNMBhaprGADR`PCFGwa
 b[�DW0 b
[�PDW0
TEMP piTEMP>GHPO pGGRPh`pGNMBha[�REG GADR`HOWN
[�PREG TEMP �zTEMPa  ISHPO
pGGRPh`pGNMBha[�REG GADR`HOWN
[�PREG TEMP }{TEMP�a yia TEMPFGGPO pGGRPh`pGNMBhaprGADR`POWNwza

 b[�REG b
[�PREG TEMP �zTEMPw{a


 HSGRA
pGGRPh`pGNMBhaprGADR`PCFGwa
 b[�DW0 b
[�PDW0 TEMP piTEMPLSGWP
pGGRPh`pGNMBhaprrGADR`PCFGwa

 b[�DW0 b
[�PDW0
TEMP piTEMPNUGP1 [�PPX GADRhGPEO
$[�GPPX STSX @GENX ��zGPEMwh

 p{STSXGENX �PESh �p �PESh "UGPS��CHSp

`�p
`�`v`UGP1`>CGP1
��zGPEMwh

 [�PPX GADRhGPEO
[�GPPX STSX piSTSX'CGPS��CHSp

`�p
`�`v`CGP1`�ECGLS��CHSp

`�p
`� `v`��
	pG2L9a���
pG2L8a���
pG2L7a���
pG2L6a���
pG2L5a���
pG2L4a���
pG2L3a���
pG2L2a���pG2L1a��� pG2L0a��GP1`aLCAGS pGGRPh`pGNMBha��zGPEMw`

 [�PPX GADR`GPEO
[�GPPX STSX pSTSXcyab}STSXbSTSX#ISMEpGGRPh`pGNMBha�z�GPES` a  MDIPI
pGGRPh`pGNMBhaprGADR`PCFGwa
 b[�DW0 b
[�PDW0 RDIS RCFG ��RCFG
p�RXEV` c{c�
wa
 c}cyRCFGwa
 �XEV` p
RCFGpRDISAUIPI pGGRPh`pGNMBhaprGADR`PCFGwa
 b[�DW0 b
[�PDW0 RDIS RCFG p{z�RXEV` wa

 c��c
p RDISpcRCFGM\ -THEN[�HBA  ��THBADO00 ��O00�'THDA
p �w
@w
�h
  `r`w
@i `�8STRD��ij ���cp `p a��jp�cria br`ybw
a `ua�MTHDS ��HEN�p�`pTHDA

a[�HBA a
@[�THBAQO00@[�THBADO00 @DO10 @DO30 [�THBAWO00[�THBABO00pB DO10p`WO00p
fp`g��g
pSTRDhf
QO00rf
ftg
g��g
pSTRDhf
DO00rf
ftg
g��g
pSTRDhf
WO00rf
ftg
g��gpSTRDhfBO00rfftggp DO30THDH THDS� THDD THDS� SPTHSPTL
#PCHV ��CHS�PTH��CHS
�PTL�J_GPEC_L6D\/_SB_PCI0XHC_GPEH\/_SB_PCI0HDASGPEH\/_SB_PCI0GLANGPEH\/_SB_PCI0XDCIGPEHIv._SB_PCI0[�
PRRE_HIDA�_UIDPCHRESV _STA
L_CRSBUF0J
V�  � �  �  �  � P �  � �  `� �  �� �  A� y
�UF0[�IOTR_HIDA�_UIDIoTraps I_CRS p
y `BUF0

G �BUF1

G �BUF2

G �BUF3

G �BUF0
AMI0�UF0
AMA0�UF1
AMI1�UF1
AMA1�UF2
AMI2�UF2
AMA2�UF3
AMI3�UF3
AMA3pITA0AMI0pITA0AMA0pITA1AMI1pITA1AMA1pITA2AMI2pITA2AMA2pITA3AMI3pITA3AMA3��TS0�BUF0`��TS1�BUF1`��TS2�BUF2`��TS3�BUF3`�[�LPCB_ADR
 _DSM�PCICh�CIDhijk�[�PC_  [�LPC_ CDID CRID H;IOD0IOD1 @ PRBL F 
XUSB O GR0B  GR19  @ ESPI[�PPMC_ADR  _DSM�PCICh�CIDhijk�[�MCB
 [�PMCB VDID @ ACBA 0 PWBA[�HSBUS_ADR  _DSM�PCICh�CIDhijk�[�MBP
��SMBP @ SBAR @ I2CE M TCOB[�MBIySBAR

[�SMBIHSTS HCONHCOMTXSADAT0DAT1HBDRPECRRXSASDATDSSXB
�STRT�p I2CEp
�STSphTXSApiHCOMp
HHCON�COMP}HSTS
�S��HSRXB �STRT��I2CEp
�STSp}h TXSAp
DHCON�COMP}HSTS
�S�AT0��SWRB�STRT�p I2CEp
�STSphTXSApiHCOMpjDAT0p
HHCON�COMP}HSTS
�S��NSRDB
�STRT��I2CEp
�STSp}h TXSApiHCOMp
HHCON�COMP}HSTS
�S�AT0��SWRW�STRT�p I2CEp
�STSphTXSApiHCOM{j
�1{zj

�0p
LHCON�COMP}HSTS
�S��JSRDW
�STRT��I2CEp
�STSp}h TXSApiHCOMp
LHCON�COMP}HSTS
�S�yDAT0
 DAT1 ��J SBLW�STRT�pkI2CEp
�STSphTXSApiHCOMp�DAT0p ap�j HBDRp
THCON��jap�`��{HSTS
�`v`[!
2��KILL�p
�STSua��jap�ja HBDR�COMP}HSTS
�S��@SBLRTBUF �STRT�pjI2CEp
�STSp}h TXSApiHCOMp
THCONp�`��{HSTS
�`v`[!
2��KILL�pDAT0�BUF p
�STSpa���TBUF p�`��{HSTS
�`v`[!
2��KILL�pHBDR�BUFa p
�STSua�COMP}HSTS
�S�BUF�OSTRTp
��`�{HSTS
@ v`["�� ��p `p�`�`�{HSTS v`[!
2�� KILL���-COMPp�`�`�{HSTS
 ��v`[!
2�� KILL�KILL}HCON
HCON}HSTS
�SMR_SB_[�
LNKA_HIDA�_UID_DIS}PARC
�ARC_PRS�RSA8_CRSRTLA
# y �TLAIRQ0p IRQ0y{PARC
 IRQ0�TLA_SRS �IRQ0�RQ0`v`p`PARC_STA�{PARC
�� ��[�
LNKB_HIDA�_UID
_DIS}PBRC
�BRC_PRS�RSB8_CRSRTLB
# y �TLBIRQ0p IRQ0y{PBRC
 IRQ0�TLB_SRS �IRQ0�RQ0`v`p`PBRC_STA�{PBRC
�� ��[�
LNKC_HIDA�_UID
_DIS}PCRC
�CRC_PRS�RSC8_CRSRTLC
# y �TLCIRQ0p IRQ0y{PCRC
 IRQ0�TLC_SRS �IRQ0�RQ0`v`p`PCRC_STA�{PCRC
�� ��[�
LNKD_HIDA�_UID
_DIS}PDRC
�DRC_PRS�RSD8_CRSRTLD
# y �TLDIRQ0p IRQ0y{PDRC
 IRQ0�TLD_SRS �IRQ0�RQ0`v`p`PDRC_STA�{PDRC
�� ��[�
LNKE_HIDA�_UID
_DIS}PERC
�ERC_PRS�RSE8_CRSRTLE
# y �TLEIRQ0p IRQ0y{PERC
 IRQ0�TLE_SRS �IRQ0�RQ0`v`p`PERC_STA�{PERC
�� ��[�
LNKF_HIDA�_UID
_DIS}PFRC
�FRC_PRS�RSF8_CRSRTLF
# y �TLFIRQ0p IRQ0y{PFRC
 IRQ0�TLF_SRS �IRQ0�RQ0`v`p`PFRC_STA�{PFRC
�� ��[�
LNKG_HIDA�_UID
_DIS}PGRC
�GRC_PRS�RSG8_CRSRTLG
# y �TLGIRQ0p IRQ0y{PGRC
 IRQ0�TLG_SRS �IRQ0�RQ0`v`p`PGRC_STA�{PGRC
�� ��[�
LNKH_HIDA�_UID
_DIS}PHRC
�HRC_PRS�RSH8_CRSRTLH
# y �TLHIRQ0p IRQ0y{PHRC
 IRQ0�TLH_SRS �IRQ0�RQ0`v`p`PHRC_STA�{PHRC
�� ��C+\ PMBV /PMBS ��MBV py\/_SB_PCI0PPMCACBA
 PMBV�MBVPWRV /PWRM ��WRV py\/_SB_PCI0PPMCPWBA
 PWRV�WRVTCBV /TCBS ��CBV py\/_SB_PCI0SBUSTCOB
 TCBV�CBV[�MIOPMBS
��PMIO PBSS G GPEC[�MLPrPMBS
�
 [�PMLP @ GE08 GE17 GE35 GE45 GE48 GE51 L[�PMLPA GS08 GS17
 GS35 GS45 GS48 GS51 GS54GS55 H[�CBATCBS
[�TCBA CPSC[�WMR PWRM [�PWMR @p DWLEHWLE[�MST PWRV
��PMST @ USBP  PMFS MPMC UWAB1PCRR
ryh
 i`rSBRG``[�CR0 `
[�PCR0DAT0 �AT0JPCRWryh
 i`rSBRG``[�CR0 `
[�PCR0DAT0 pjDAT0[�CR1 rSBRG4�
[�PCR1DAT1 pDAT1aPCROpPCRRhi`p}`j aPCRWhiaPCRApPCRRhi`p{`j
aPCRWhiaPCAOpPCRRhi`p}{`j k aPCRWhiaO._SB_PCI0LTRN OBFN LMSL LNSL [�
GLAN_ADR  _DSM�PCICh�CIDhijk�[�LBA  [�GLBA DVID @e PMEE PMES_PRW
�PRW
m
_DSWphPMEE*GPEH ��VID���MEEPMESpPMES�LAN
H[._SB_PCI0[�ZXHC__ADR  [�PRT  [�XPRT DVID @9D0D3 PMEE PMES @
MW13MW14  MB13MB14  @PR2_ PR2M PR3_ PR3M XFLT <_DSM�PCICh�CIDhijk��
�4���+4�#��
piXFLT� _S3D � _S4D � _S3W � _S4W �_S0W ��FLT ���_PRW �PRW
m
_DSWphPMEE,_INI �[\/_SB_PCI0XHC_RHUBINIR ^.RHUBINIR-GPEH
��VID�pPMES`pPMES��MEE`�HC_
[�HCP rGPCB
  [�XHCP PDBM @MEMB@USRA��CHVSPTH���SSPA��CHVSPTH���XRST
 J_PS0��VID�pMEMBbpPDBMa{PDBM��PDBMpD0D3cp D0D3pXWMBMEMB}a
PDBM[�C11 XWMB ��MC11 �@ UPSWp
UPSW{PDBM��PDBMpbMEMBpaPDBM�[\/_SB_PCI0XHC_PS0X PS0X��WAB�D0D3 �^.XDCID0I3
pMPMC�PMFS["

O_PS3��VID�pMEMBbpPDBMa{PDBM��PDBMp D0D3pXWMBMEMB}a
PDBM[�C11 XWMB ��MC11 �@ UPSWp
UPSW{PDBM��PDBMp
D0D3pbMEMBpaPDBM�[\/_SB_PCI0XHC_PS3X PS3X��WAB�D0D3
�^^.XDCID0I3
�^.XDCIDVID�MPMC�PMFS["

"CUID ��
����Pj$#���[�RHUB_ADR 2_PS0��VID��[\/_SB_PCI0XHC_RHUBPS0X
PS0X2_PS2��VID��[\/_SB_PCI0XHC_RHUBPS2X
PS2X2_PS3��VID��[\/_SB_PCI0XHC_RHUBPS3X PS3X[�HS01_ADR[�HS02_ADR
[�HS03_ADR
[�HS04_ADR
[�HS05_ADR
[�HS06_ADR
[�HS07_ADR
[�HS08_ADR
[�HS09_ADR
	[�HS10_ADR

[�USR1_ADR �USRA [�USR2_ADR �USRA [�SS01_ADR �SSPA [�SS02_ADR �SSPA
[�SS03_ADR �SSPA
 [�SS04_ADR �SSPA
 [�SS05_ADR �SSPA
 [�SS06_ADR �SSPA
 ��CHVSPTHH
/_SB_PCI0XHC_RHUB[�HS11_ADR
[�HS12_ADR
[�HS13_ADR
[�HS14_ADR
[�SS07_ADR �SSPA
 [�SS08_ADR �SSPA
 [�SS09_ADR �SSPA
 [�SS10_ADR �SSPA
	 N2._SB_PCI0[�2XDCI_ADR  [�TGD  [�OTGDDVID @XDCB@ @.D0I3 N
	 PMEE PMESXDBA �XDCB ��D _DSM_T_0 �PCICh�CIDhijk��
Յ+s�J�K��K��pj_T_0��T_0 �s���T_0����T_0
[�DBW XDBA  [�XDBW �| U2CPU3CP 4PUPS PURC   UXPE p�k a�� p UXPEp
PURCp `��

[!
du`p PUPSp `���[!
d��U2CP �3CP �`��U2CP ��U3CP ���
��U2CP ��U3CP p
PUPSp `���[!
d��U2CP
�3CP
�`��U2CP
��U3CP
pPURCp
UXPE����T_0
����T_0
[�DBD XDBA  [�XDBD �c CSFR [�DW2 XDBA  [�XDW2 �| OTHC��THC pCSFRp `��
d��SFR �"�� _DDNSPT XHCI controller _STR+
(S P T X H C I c o n t r o l l e r  _S0W �_STA ��DVID����_PRW �PRW
m
_DSWphPMEE-GPEH ��VID�pPMES`pPMES��MEE`�DCI
�._SB_PCI0[�)HDAS_ADR  [�DAR  [�HDARVDID @" MBCG I PMEE
PMES_S0W
_DSWphPMEE_PRW �PRW
m
;GPEH ��DID����MEEPMESADBGHDAS GPEH pPMES�DAS
NBUF3
0�  y HAUWA��CHS��^.LPCBCRID ����^.LPCBCRID ���^.LPCBCRID���^.LPCBCRID
	��G_INI ADBGHDAS _INI �BUF
NBAS�BUF
NMAS�BUF
&NLENpNHLANBASrNHLAtNHLL NMASpNHLLNLEN��UWAp MBCGF_DSM_T_0 ADBGHDAS _DSM
�PCICh�CIDhijk��
n��l��{]��� pj_T_0��T_0 ����T_0ADBG_DSM Fun 1 NHLT �BUF���T_0
ADBG_DSM Fun 2 FMSK �DFM���T_0
ADBG_DSM Fun 3 PPMS ��ADBG_DSM Fun NOK � �DBG_DSM UUID NOK [�7RP01_ADR ��RPA1
�PA1��  *_INI pLTR1LTRNpPML1LMSLpPNL1LNSLpOBF1OBFN[�XCS �[�PXCS VDID @&L0SE
LDIS   LASX 2ABPX PDCX PDSX  ( PSPX O D3HT N HPEXPMEX 0
L23EL23R � LEDM[�PXCS@ @n HPSXPMSXLTRV J _DSM_T_0 ��
��S5zM���M�p� _T_0��T_0 OPTS
 �PTS FUN0�PTS
FUN4�PTS
FUN6�PTS
FUN8�PTS
	FUN9��i
pFUN0�LTREpFUN6�OBFFpFUN4��CR1��i
pFUN8pFUN9�PTS���T_0
��i
�OBFN�
  ��
 ���T_0
�
�i
� LTRN��LMSL �NSL ��CHSSPTHpFLMSLpFLNSL���CHSSPTLpLMSLpLNSLp{zLMSL


 �TRV p{LMSL�LTRV p{zLNSL


 �TRV
 p{LNSL�LTRV
 �TRV�����T_0
��CR1��i
����T_0
	��CR1��i
�P��� [�PXSX_ADR _PRW �PRW
i
-HPME�PMSXp
��`pPMSX�PMSXv`�p `�XSX
_PRW �PRW
i
_PRT �PICM�R04�R04[�7RP02_ADR ��RPA2 �PA2��  *_INI
pLTR2LTRNpPML2LMSLpPNL2LNSLpOBF2OBFN[�XCS �[�PXCS VDID @&L0SE LDIS   LASX
2ABPX PDCX PDSX  ( PSPX O D3HT N HPEXPMEX 0 L23EL23R �
LEDM[�PXCS@ @n HPSXPMSXLTRV J _DSM_T_0 ��
��S5zM���M�p� _T_0��T_0 OPTS
 �PTS FUN0�PTS
FUN4�PTS
FUN6�PTS
FUN8�PTS
	FUN9��i
pFUN0�LTREpFUN6�OBFFpFUN4��CR1��i
pFUN8pFUN9�PTS���T_0
��i
�OBFN�
  ��
 ���T_0
�
�i
� LTRN��LMSL �NSL ��CHSSPTHpFLMSLpFLNSL���CHSSPTLpLMSLpLNSLp{zLMSL


 �TRV p{LMSL�LTRV p{zLNSL


 �TRV
 p{LNSL�LTRV
 �TRV�����T_0
��CR1��i
����T_0
	��CR1��i
�P��� [�PXSX_ADR _PRW �PRW
i
-HPME�PMSXp
��`pPMSX�PMSXv`�p `�XSX
_PRW �PRW
i
_PRT �PICM�R05�R05[�7RP03_ADR ��RPA3 �PA3��  *_INI
pLTR3LTRNpPML3LMSLpPNL3LNSLpOBF3OBFN[�XCS �[�PXCS VDID @&L0SE LDIS   LASX
2ABPX PDCX PDSX  ( PSPX O D3HT N HPEXPMEX 0 L23EL23R �
LEDM[�PXCS@ @n HPSXPMSXLTRV J _DSM_T_0 ��
��S5zM���M�p� _T_0��T_0 OPTS
 �PTS FUN0�PTS
FUN4�PTS
FUN6�PTS
FUN8�PTS
	FUN9��i
pFUN0�LTREpFUN6�OBFFpFUN4��CR1��i
pFUN8pFUN9�PTS���T_0
��i
�OBFN�
  ��
 ���T_0
�
�i
� LTRN��LMSL �NSL ��CHSSPTHpFLMSLpFLNSL���CHSSPTLpLMSLpLNSLp{zLMSL


 �TRV p{LMSL�LTRV p{zLNSL


 �TRV
 p{LNSL�LTRV
 �TRV�����T_0
��CR1��i
����T_0
	��CR1��i
�P��� [�PXSX_ADR _PRW �PRW
i
-HPME�PMSXp
��`pPMSX�PMSXv`�p `�XSX
_PRW �PRW
i
_PRT �PICM�R06�R06[�7RP04_ADR ��RPA4 �PA4��  *_INI
pLTR4LTRNpPML4LMSLpPNL4LNSLpOBF4OBFN[�XCS �[�PXCS VDID @&L0SE LDIS   LASX
2ABPX PDCX PDSX  ( PSPX O D3HT N HPEXPMEX 0 L23EL23R �
LEDM[�PXCS@ @n HPSXPMSXLTRV J _DSM_T_0 ��
��S5zM���M�p� _T_0��T_0 OPTS
 �PTS FUN0�PTS
FUN4�PTS
FUN6�PTS
FUN8�PTS
	FUN9��i
pFUN0�LTREpFUN6�OBFFpFUN4��CR1��i
pFUN8pFUN9�PTS���T_0
��i
�OBFN�
  ��
 ���T_0
�
�i
� LTRN��LMSL �NSL ��CHSSPTHpFLMSLpFLNSL���CHSSPTLpLMSLpLNSLp{zLMSL


 �TRV p{LMSL�LTRV p{zLNSL


 �TRV
 p{LNSL�LTRV
 �TRV�����T_0
��CR1��i
����T_0
	��CR1��i
�P��� [�PXSX_ADR _PRW �PRW
i
-HPME�PMSXp
��`pPMSX�PMSXv`�p `�XSX
_PRW �PRW
i
_PRT �PICM�R07�R07[�7RP05_ADR ��RPA5 �PA5��  *_INI
pLTR5LTRNpPML5LMSLpPNL5LNSLpOBF5OBFN[�XCS �[�PXCS VDID @&L0SE LDIS   LASX
2ABPX PDCX PDSX  ( PSPX O D3HT N HPEXPMEX 0 L23EL23R �
LEDM[�PXCS@ @n HPSXPMSXLTRV J _DSM_T_0 ��
��S5zM���M�p� _T_0��T_0 OPTS
 �PTS FUN0�PTS
FUN4�PTS
FUN6�PTS
FUN8�PTS
	FUN9��i
pFUN0�LTREpFUN6�OBFFpFUN4��CR1��i
pFUN8pFUN9�PTS���T_0
��i
�OBFN�
  ��
 ���T_0
�
�i
� LTRN��LMSL �NSL ��CHSSPTHpFLMSLpFLNSL���CHSSPTLpLMSLpLNSLp{zLMSL


 �TRV p{LMSL�LTRV p{zLNSL


 �TRV
 p{LNSL�LTRV
 �TRV�����T_0
��CR1��i
����T_0
	��CR1��i
�P��� [�PXSX_ADR _PRW �PRW
i
-HPME�PMSXp
��`pPMSX�PMSXv`�p `�XSX
_PRW �PRW
i
_PRT �PICM�R04�R04[�7RP06_ADR ��RPA6 �PA6��  *_INI
pLTR6LTRNpPML6LMSLpPNL6LNSLpOBF6OBFN[�XCS �[�PXCS VDID @&L0SE LDIS   LASX
2ABPX PDCX PDSX  ( PSPX O D3HT N HPEXPMEX 0 L23EL23R �
LEDM[�PXCS@ @n HPSXPMSXLTRV J _DSM_T_0 ��
��S5zM���M�p� _T_0��T_0 OPTS
 �PTS FUN0�PTS
FUN4�PTS
FUN6�PTS
FUN8�PTS
	FUN9��i
pFUN0�LTREpFUN6�OBFFpFUN4��CR1��i
pFUN8pFUN9�PTS���T_0
��i
�OBFN�
  ��
 ���T_0
�
�i
� LTRN��LMSL �NSL ��CHSSPTHpFLMSLpFLNSL���CHSSPTLpLMSLpLNSLp{zLMSL


 �TRV p{LMSL�LTRV p{zLNSL


 �TRV
 p{LNSL�LTRV
 �TRV�����T_0
��CR1��i
����T_0
	��CR1��i
�P��� [�PXSX_ADR _PRW �PRW
i
-HPME�PMSXp
��`pPMSX�PMSXv`�p `�XSX
_PRW �PRW
i
_PRT �PICM�R05�R05[�7RP07_ADR ��RPA7 �PA7��  *_INI
pLTR7LTRNpPML7LMSLpPNL7LNSLpOBF7OBFN[�XCS �[�PXCS VDID @&L0SE LDIS   LASX
2ABPX PDCX PDSX  ( PSPX O D3HT N HPEXPMEX 0 L23EL23R �
LEDM[�PXCS@ @n HPSXPMSXLTRV J _DSM_T_0 ��
��S5zM���M�p� _T_0��T_0 OPTS
 �PTS FUN0�PTS
FUN4�PTS
FUN6�PTS
FUN8�PTS
	FUN9��i
pFUN0�LTREpFUN6�OBFFpFUN4��CR1��i
pFUN8pFUN9�PTS���T_0
��i
�OBFN�
  ��
 ���T_0
�
�i
� LTRN��LMSL �NSL ��CHSSPTHpFLMSLpFLNSL���CHSSPTLpLMSLpLNSLp{zLMSL


 �TRV p{LMSL�LTRV p{zLNSL


 �TRV
 p{LNSL�LTRV
 �TRV�����T_0
��CR1��i
����T_0
	��CR1��i
�P��� [�PXSX_ADR _PRW �PRW
i
-HPME�PMSXp
��`pPMSX�PMSXv`�p `�XSX
_PRW �PRW
i
_PRT �PICM�R06�R06[�7RP08_ADR ��RPA8 �PA8��  *_INI
pLTR8LTRNpPML8LMSLpPNL8LNSLpOBF8OBFN[�XCS �[�PXCS VDID @&L0SE LDIS   LASX
2ABPX PDCX PDSX  ( PSPX O D3HT N HPEXPMEX 0 L23EL23R �
LEDM[�PXCS@ @n HPSXPMSXLTRV J _DSM_T_0 ��
��S5zM���M�p� _T_0��T_0 OPTS
 �PTS FUN0�PTS
FUN4�PTS
FUN6�PTS
FUN8�PTS
	FUN9��i
pFUN0�LTREpFUN6�OBFFpFUN4��CR1��i
pFUN8pFUN9�PTS���T_0
��i
�OBFN�
  ��
 ���T_0
�
�i
� LTRN��LMSL �NSL ��CHSSPTHpFLMSLpFLNSL���CHSSPTLpLMSLpLNSLp{zLMSL


 �TRV p{LMSL�LTRV p{zLNSL


 �TRV
 p{LNSL�LTRV
 �TRV�����T_0
��CR1��i
����T_0
	��CR1��i
�P��� [�PXSX_ADR _PRW �PRW
i
-HPME�PMSXp
��`pPMSX�PMSXv`�p `�XSX
_PRW �PRW
i
_PRT �PICM�R07�R07[�7RP09_ADR ��RPA9 �PA9��  *_INI
pLTR9LTRNpPML9LMSLpPNL9LNSLpOBF9OBFN[�XCS �[�PXCS VDID @&L0SE LDIS   LASX
2ABPX PDCX PDSX  ( PSPX O D3HT N HPEXPMEX 0 L23EL23R �
LEDM[�PXCS@ @n HPSXPMSXLTRV J _DSM_T_0 ��
��S5zM���M�p� _T_0��T_0 OPTS
 �PTS FUN0�PTS
FUN4�PTS
FUN6�PTS
FUN8�PTS
	FUN9��i
pFUN0�LTREpFUN6�OBFFpFUN4��CR1��i
pFUN8pFUN9�PTS���T_0
��i
�OBFN�
  ��
 ���T_0
�
�i
� LTRN��LMSL �NSL ��CHSSPTHpFLMSLpFLNSL���CHSSPTLpLMSLpLNSLp{zLMSL


 �TRV p{LMSL�LTRV p{zLNSL


 �TRV
 p{LNSL�LTRV
 �TRV�����T_0
��CR1��i
����T_0
	��CR1��i
�P��� [�PXSX_ADR _PRW �PRW
i
-HPME�PMSXp
��`pPMSX�PMSXv`�p `�XSX
_PRW �PRW
i
_PRT �PICM�R04�R04[�7RP10_ADR ��RPAA �PAA��  *_INI
pLTRALTRNpPMLALMSLpPNLALNSLpOBFAOBFN[�XCS �[�PXCS VDID @&L0SE LDIS   LASX
2ABPX PDCX PDSX  ( PSPX O D3HT N HPEXPMEX 0 L23EL23R �
LEDM[�PXCS@ @n HPSXPMSXLTRV J _DSM_T_0 ��
��S5zM���M�p� _T_0��T_0 OPTS
 �PTS FUN0�PTS
FUN4�PTS
FUN6�PTS
FUN8�PTS
	FUN9��i
pFUN0�LTREpFUN6�OBFFpFUN4��CR1��i
pFUN8pFUN9�PTS���T_0
��i
�OBFN�
  ��
 ���T_0
�
�i
� LTRN��LMSL �NSL ��CHSSPTHpFLMSLpFLNSL���CHSSPTLpLMSLpLNSLp{zLMSL


 �TRV p{LMSL�LTRV p{zLNSL


 �TRV
 p{LNSL�LTRV
 �TRV�����T_0
��CR1��i
����T_0
	��CR1��i
�P��� [�PXSX_ADR _PRW �PRW
i
-HPME�PMSXp
��`pPMSX�PMSXv`�p `�XSX
_PRW �PRW
i
_PRT �PICM�R05�R05[�7RP11_ADR ��RPAB �PAB��  *_INI
pLTRBLTRNpPMLBLMSLpPNLBLNSLpOBFBOBFN[�XCS �[�PXCS VDID @&L0SE LDIS   LASX
2ABPX PDCX PDSX  ( PSPX O D3HT N HPEXPMEX 0 L23EL23R �
LEDM[�PXCS@ @n HPSXPMSXLTRV J _DSM_T_0 ��
��S5zM���M�p� _T_0��T_0 OPTS
 �PTS FUN0�PTS
FUN4�PTS
FUN6�PTS
FUN8�PTS
	FUN9��i
pFUN0�LTREpFUN6�OBFFpFUN4��CR1��i
pFUN8pFUN9�PTS���T_0
��i
�OBFN�
  ��
 ���T_0
�
�i
� LTRN��LMSL �NSL ��CHSSPTHpFLMSLpFLNSL���CHSSPTLpLMSLpLNSLp{zLMSL


 �TRV p{LMSL�LTRV p{zLNSL


 �TRV
 p{LNSL�LTRV
 �TRV�����T_0
��CR1��i
����T_0
	��CR1��i
�P��� [�PXSX_ADR _PRW �PRW
i
-HPME�PMSXp
��`pPMSX�PMSXv`�p `�XSX
_PRW �PRW
i
_PRT �PICM�R06�R06[�7RP12_ADR ��RPAC �PAC��  *_INI
pLTRCLTRNpPMLCLMSLpPNLCLNSLpOBFCOBFN[�XCS �[�PXCS VDID @&L0SE LDIS   LASX
2ABPX PDCX PDSX  ( PSPX O D3HT N HPEXPMEX 0 L23EL23R �
LEDM[�PXCS@ @n HPSXPMSXLTRV J _DSM_T_0 ��
��S5zM���M�p� _T_0��T_0 OPTS
 �PTS FUN0�PTS
FUN4�PTS
FUN6�PTS
FUN8�PTS
	FUN9��i
pFUN0�LTREpFUN6�OBFFpFUN4��CR1��i
pFUN8pFUN9�PTS���T_0
��i
�OBFN�
  ��
 ���T_0
�
�i
� LTRN��LMSL �NSL ��CHSSPTHpFLMSLpFLNSL���CHSSPTLpLMSLpLNSLp{zLMSL


 �TRV p{LMSL�LTRV p{zLNSL


 �TRV
 p{LNSL�LTRV
 �TRV�����T_0
��CR1��i
����T_0
	��CR1��i
�P��� [�PXSX_ADR _PRW �PRW
i
-HPME�PMSXp
��`pPMSX�PMSXv`�p `�XSX
_PRW �PRW
i
_PRT �PICM�R07�R07[�7RP13_ADR ��RPAD �PAD��  *_INI
pLTRDLTRNpPMLDLMSLpPNLDLNSLpOBFDOBFN[�XCS �[�PXCS VDID @&L0SE LDIS   LASX
2ABPX PDCX PDSX  ( PSPX O D3HT N HPEXPMEX 0 L23EL23R �
LEDM[�PXCS@ @n HPSXPMSXLTRV J _DSM_T_0 ��
��S5zM���M�p� _T_0��T_0 OPTS
 �PTS FUN0�PTS
FUN4�PTS
FUN6�PTS
FUN8�PTS
	FUN9��i
pFUN0�LTREpFUN6�OBFFpFUN4��CR1��i
pFUN8pFUN9�PTS���T_0
��i
�OBFN�
  ��
 ���T_0
�
�i
� LTRN��LMSL �NSL ��CHSSPTHpFLMSLpFLNSL���CHSSPTLpLMSLpLNSLp{zLMSL


 �TRV p{LMSL�LTRV p{zLNSL


 �TRV
 p{LNSL�LTRV
 �TRV�����T_0
��CR1��i
����T_0
	��CR1��i
�P��� [�PXSX_ADR _PRW �PRW
i
-HPME�PMSXp
��`pPMSX�PMSXv`�p `�XSX
_PRW �PRW
i
_PRT �PICM�R04�R04[�7RP14_ADR ��RPAE �PAE��  *_INI
pLTRELTRNpPMLELMSLpPNLELNSLpOBFEOBFN[�XCS �[�PXCS VDID @&L0SE LDIS   LASX
2ABPX PDCX PDSX  ( PSPX O D3HT N HPEXPMEX 0 L23EL23R �
LEDM[�PXCS@ @n HPSXPMSXLTRV J _DSM_T_0 ��
��S5zM���M�p� _T_0��T_0 OPTS
 �PTS FUN0�PTS
FUN4�PTS
FUN6�PTS
FUN8�PTS
	FUN9��i
pFUN0�LTREpFUN6�OBFFpFUN4��CR1��i
pFUN8pFUN9�PTS���T_0
��i
�OBFN�
  ��
 ���T_0
�
�i
� LTRN��LMSL �NSL ��CHSSPTHpFLMSLpFLNSL���CHSSPTLpLMSLpLNSLp{zLMSL


 �TRV p{LMSL�LTRV p{zLNSL


 �TRV
 p{LNSL�LTRV
 �TRV�����T_0
��CR1��i
����T_0
	��CR1��i
�P��� [�PXSX_ADR _PRW �PRW
i
-HPME�PMSXp
��`pPMSX�PMSXv`�p `�XSX
_PRW �PRW
i
_PRT �PICM�R05�R05[�7RP15_ADR ��RPAF �PAF��  *_INI
pLTRFLTRNpPMLFLMSLpPNLFLNSLpOBFFOBFN[�XCS �[�PXCS VDID @&L0SE LDIS   LASX
2ABPX PDCX PDSX  ( PSPX O D3HT N HPEXPMEX 0 L23EL23R �
LEDM[�PXCS@ @n HPSXPMSXLTRV J _DSM_T_0 ��
��S5zM���M�p� _T_0��T_0 OPTS
 �PTS FUN0�PTS
FUN4�PTS
FUN6�PTS
FUN8�PTS
	FUN9��i
pFUN0�LTREpFUN6�OBFFpFUN4��CR1��i
pFUN8pFUN9�PTS���T_0
��i
�OBFN�
  ��
 ���T_0
�
�i
� LTRN��LMSL �NSL ��CHSSPTHpFLMSLpFLNSL���CHSSPTLpLMSLpLNSLp{zLMSL


 �TRV p{LMSL�LTRV p{zLNSL


 �TRV
 p{LNSL�LTRV
 �TRV�����T_0
��CR1��i
����T_0
	��CR1��i
�P��� [�PXSX_ADR _PRW �PRW
i
-HPME�PMSXp
��`pPMSX�PMSXv`�p `�XSX
_PRW �PRW
i
_PRT �PICM�R06�R06[�7RP16_ADR ��RPAG �PAG��  *_INI
pLTRGLTRNpPMLGLMSLpPNLGLNSLpOBFGOBFN[�XCS �[�PXCS VDID @&L0SE LDIS   LASX
2ABPX PDCX PDSX  ( PSPX O D3HT N HPEXPMEX 0 L23EL23R �
LEDM[�PXCS@ @n HPSXPMSXLTRV J _DSM_T_0 ��
��S5zM���M�p� _T_0��T_0 OPTS
 �PTS FUN0�PTS
FUN4�PTS
FUN6�PTS
FUN8�PTS
	FUN9��i
pFUN0�LTREpFUN6�OBFFpFUN4��CR1��i
pFUN8pFUN9�PTS���T_0
��i
�OBFN�
  ��
 ���T_0
�
�i
� LTRN��LMSL �NSL ��CHSSPTHpFLMSLpFLNSL���CHSSPTLpLMSLpLNSLp{zLMSL


 �TRV p{LMSL�LTRV p{zLNSL


 �TRV
 p{LNSL�LTRV
 �TRV�����T_0
��CR1��i
����T_0
	��CR1��i
�P��� [�PXSX_ADR _PRW �PRW
i
-HPME�PMSXp
��`pPMSX�PMSXv`�p `�XSX
_PRW �PRW
i
_PRT �PICM�R07�R07[�7RP17_ADR ��RPAH �PAH��  *_INI
pLTRHLTRNpPMLHLMSLpPNLHLNSLpOBFHOBFN[�XCS �[�PXCS VDID @&L0SE LDIS   LASX
2ABPX PDCX PDSX  ( PSPX O D3HT N HPEXPMEX 0 L23EL23R �
LEDM[�PXCS@ @n HPSXPMSXLTRV J _DSM_T_0 ��
��S5zM���M�p� _T_0��T_0 OPTS
 �PTS FUN0�PTS
FUN4�PTS
FUN6�PTS
FUN8�PTS
	FUN9��i
pFUN0�LTREpFUN6�OBFFpFUN4��CR1��i
pFUN8pFUN9�PTS���T_0
��i
�OBFN�
  ��
 ���T_0
�
�i
� LTRN��LMSL �NSL ��CHSSPTHpFLMSLpFLNSL���CHSSPTLpLMSLpLNSLp{zLMSL


 �TRV p{LMSL�LTRV p{zLNSL


 �TRV
 p{LNSL�LTRV
 �TRV�����T_0
��CR1��i
����T_0
	��CR1��i
�P��� [�PXSX_ADR _PRW �PRW
i
-HPME�PMSXp
��`pPMSX�PMSXv`�p `�XSX
_PRW �PRW
i
_PRT �PICM�R04�R04[�7RP18_ADR ��RPAI �PAI��  *_INI
pLTRILTRNpPMLILMSLpPNLILNSLpOBFIOBFN[�XCS �[�PXCS VDID @&L0SE LDIS   LASX
2ABPX PDCX PDSX  ( PSPX O D3HT N HPEXPMEX 0 L23EL23R �
LEDM[�PXCS@ @n HPSXPMSXLTRV J _DSM_T_0 ��
��S5zM���M�p� _T_0��T_0 OPTS
 �PTS FUN0�PTS
FUN4�PTS
FUN6�PTS
FUN8�PTS
	FUN9��i
pFUN0�LTREpFUN6�OBFFpFUN4��CR1��i
pFUN8pFUN9�PTS���T_0
��i
�OBFN�
  ��
 ���T_0
�
�i
� LTRN��LMSL �NSL ��CHSSPTHpFLMSLpFLNSL���CHSSPTLpLMSLpLNSLp{zLMSL


 �TRV p{LMSL�LTRV p{zLNSL


 �TRV
 p{LNSL�LTRV
 �TRV�����T_0
��CR1��i
����T_0
	��CR1��i
�P��� [�PXSX_ADR _PRW �PRW
i
-HPME�PMSXp
��`pPMSX�PMSXv`�p `�XSX
_PRW �PRW
i
_PRT �PICM�R05�R05[�7RP19_ADR ��RPAJ �PAJ��  *_INI
pLTRJLTRNpPMLJLMSLpPNLJLNSLpOBFJOBFN[�XCS �[�PXCS VDID @&L0SE LDIS   LASX
2ABPX PDCX PDSX  ( PSPX O D3HT N HPEXPMEX 0 L23EL23R �
LEDM[�PXCS@ @n HPSXPMSXLTRV J _DSM_T_0 ��
��S5zM���M�p� _T_0��T_0 OPTS
 �PTS FUN0�PTS
FUN4�PTS
FUN6�PTS
FUN8�PTS
	FUN9��i
pFUN0�LTREpFUN6�OBFFpFUN4��CR1��i
pFUN8pFUN9�PTS���T_0
��i
�OBFN�
  ��
 ���T_0
�
�i
� LTRN��LMSL �NSL ��CHSSPTHpFLMSLpFLNSL���CHSSPTLpLMSLpLNSLp{zLMSL


 �TRV p{LMSL�LTRV p{zLNSL


 �TRV
 p{LNSL�LTRV
 �TRV�����T_0
��CR1��i
����T_0
	��CR1��i
�P��� [�PXSX_ADR _PRW �PRW
i
-HPME�PMSXp
��`pPMSX�PMSXv`�p `�XSX
_PRW �PRW
i
_PRT �PICM�R06�R06[�7RP20_ADR ��RPAK �PAK��  *_INI
pLTRKLTRNpPMLKLMSLpPNLKLNSLpOBFKOBFN[�XCS �[�PXCS VDID @&L0SE LDIS   LASX
2ABPX PDCX PDSX  ( PSPX O D3HT N HPEXPMEX 0 L23EL23R �
LEDM[�PXCS@ @n HPSXPMSXLTRV J _DSM_T_0 ��
��S5zM���M�p� _T_0��T_0 OPTS
 �PTS FUN0�PTS
FUN4�PTS
FUN6�PTS
FUN8�PTS
	FUN9��i
pFUN0�LTREpFUN6�OBFFpFUN4��CR1��i
pFUN8pFUN9�PTS���T_0
��i
�OBFN�
  ��
 ���T_0
�
�i
� LTRN��LMSL �NSL ��CHSSPTHpFLMSLpFLNSL���CHSSPTLpLMSLpLNSLp{zLMSL


 �TRV p{LMSL�LTRV p{zLNSL


 �TRV
 p{LNSL�LTRV
 �TRV�����T_0
��CR1��i
����T_0
	��CR1��i
�P��� [�PXSX_ADR _PRW �PRW
i
-HPME�PMSXp
��`pPMSX�PMSXv`�p `�XSX
_PRW �PRW
i
_PRT �PICM�R07�R07[��T0_ADR  9_DSM�PCICh�CIDhijk�[\/_SB_PCI0SAT0SDSM
�DSMhijk�[�PRT0_ADR�PRT1_ADR�[�PRT2_ADR�[�PRT3_ADR�[�PRT4_ADR�[�PRT5_ADR�KRDCA_T_0
[�PAL rGPCBr � i
[�RPALRPCD [�PAC rGPCB�
[�EPACCAIR CADR [�CRG rGPCB�
[�NCRGCRGC ��
��phCRGC�p� _T_0��T_0 �PCD���T_0
piCAIR�ADR���T_0{jRPCD`}k``p`RPCD���T_0
piCAIR{jCADR`}k``p`CADR���RPD0 RDCAh
�� RPD3 RDCAh
��
[�BNVM1_ADR�PRBI PRBD PCMD NCRN NITV NPMV NPCV NL1V ND2V ND1V NLRV
NLDV NEAV NEBV NECV NRAV NMBV NMVV NPBV NPVV EPD0RDCANCRNrNPMV
 �
EPD3RDCANCRNrNPMV
 �

J CNRS��ITV �RDCANCRN

RDCANCRN

RDCANCRN

RDCANCRN

RDCANCRN

RDCANCRN
$
RDCANCRN
�PCMD
RDCANCRNPRBI PRBD
��NL1V RDCANCRNrNL1V
  �D2V
RDCANCRNrNL1V

{ND1V�
RDCANCRNrNL1V
 �ND1V
��NLRV RDCANCRNrNLRV
 �NLDV
RDCANCRNrNPCV
 ��EAV�RDCANCRNrNPCV
( �NECV
RDCANCRNrNPCV
 �EBV
RDCANCRN
h�NRAV��NEAV
@
@RDCANCRN
P����RDCANCRN
R  [!

RDCANCRNrNPCV
 �{NEAV

��NMVV RDCANCRNNMBV NMVV
��NPVV RDCANCRNNPBV NPVV
G_PS3��ITV �pRDCANCRN

PCMD��ITVp
$PRBIpRDCANCRN
$
PRBD���ITV
p
PRBIpRDCANCRN

PRBDEPD3RPD3NCRN?_PS0��ITV �RPD0NCRNEPD0pRDCANCRNrNPMV

`��`
 CNRSM _INI
pNIT1NITVpNPM1NPMVpNPC1NPCVpNL11NL1VpND21ND2VpND11ND1VpNLR1NLRVpNLD1NLDVpNEA1NEAVpNEB1NEBVpNEC1NECVpNRA1NRAVpNMB1NMBVpNMV1NMVVpNPB1NPBVpNPV1NPVVp
NCRN[�BNVM2_ADR�PRBI PRBD PCMD NCRN NITV NPMV NPCV NL1V ND2V ND1V
NLRV NLDV NEAV NEBV NECV NRAV NMBV NMVV NPBV NPVV EPD0RDCANCRNrNPMV
 �
EPD3RDCANCRNrNPMV
 �

J CNRS��ITV �RDCANCRN

RDCANCRN

RDCANCRN

RDCANCRN

RDCANCRN

RDCANCRN
$
RDCANCRN
�PCMD
RDCANCRNPRBI PRBD
��NL1V RDCANCRNrNL1V
  �D2V
RDCANCRNrNL1V

{ND1V�
RDCANCRNrNL1V
 �ND1V
��NLRV RDCANCRNrNLRV
 �NLDV
RDCANCRNrNPCV
 ��EAV�RDCANCRNrNPCV
( �NECV
RDCANCRNrNPCV
 �EBV
RDCANCRN
h�NRAV��NEAV
@
@RDCANCRN
P����RDCANCRN
R  [!

RDCANCRNrNPCV
 �{NEAV

��NMVV RDCANCRNNMBV NMVV
��NPVV RDCANCRNNPBV NPVV
G_PS3��ITV �pRDCANCRN

PCMD��ITVp
$PRBIpRDCANCRN
$
PRBD���ITV
p
PRBIpRDCANCRN

PRBDEPD3RPD3NCRN?_PS0��ITV �RPD0NCRNEPD0pRDCANCRNrNPMV

`��`
 CNRSM _INI
pNIT2NITVpNPM2NPMVpNPC2NPCVpNL12NL1VpND22ND2VpND12ND1VpNLR2NLRVpNLD2NLDVpNEA2NEAVpNEB2NEBVpNEC2NECVpNRA2NRAVpNMB2NMBVpNMV2NMVVpNPB2NPBVpNPV2NPVVpNCRN[�BNVM3_ADR�PRBI
PRBD PCMD NCRN NITV NPMV NPCV NL1V ND2V ND1V NLRV NLDV NEAV NEBV
NECV NRAV NMBV NMVV NPBV NPVV EPD0RDCANCRNrNPMV
 �
EPD3RDCANCRNrNPMV
 �

J CNRS��ITV �RDCANCRN

RDCANCRN

RDCANCRN

RDCANCRN

RDCANCRN

RDCANCRN
$
RDCANCRN
�PCMD
RDCANCRNPRBI PRBD
��NL1V RDCANCRNrNL1V
  �D2V
RDCANCRNrNL1V

{ND1V�
RDCANCRNrNL1V
 �ND1V
��NLRV RDCANCRNrNLRV
 �NLDV
RDCANCRNrNPCV
 ��EAV�RDCANCRNrNPCV
( �NECV
RDCANCRNrNPCV
 �EBV
RDCANCRN
h�NRAV��NEAV
@
@RDCANCRN
P����RDCANCRN
R  [!

RDCANCRNrNPCV
 �{NEAV

��NMVV RDCANCRNNMBV NMVV
��NPVV RDCANCRNNPBV NPVV
G_PS3��ITV �pRDCANCRN

PCMD��ITVp
$PRBIpRDCANCRN
$
PRBD���ITV
p
PRBIpRDCANCRN

PRBDEPD3RPD3NCRN?_PS0��ITV �RPD0NCRNEPD0pRDCANCRNrNPMV

`��`
 CNRSN _INI
pNIT3NITVpNPM3NPMVpNPC3NPCVpNL13NL1VpND23ND2VpND13ND1VpNLR3NLRVpNLD3NLDVpNEA3NEAVpNEB3NEBVpNEC3NECVpNRA3NRAVpNMB3NMBVpNMV3NMVVpNPB3NPBVpNPV3NPVVp
NCRN[�CIO2_STA ��IOE���_HIDINT343E ?_CRS CBUF
�  �  @� y �BUF
CIOVpCIOICIOV�BUF[�TERM_HIDINT343D _UID?_CRS RBUF
�  �� �  y �BUF
IRQNpTIRQIRQN�BUF_STA ��AEN ���IRQ ��@._SB_PCI02LPD3 [�CB1 rh
�
[�ICB1TEMP }TEMP
TEMPpTEMP`&LHRV [�CB1 rh

[�ICB1HRV_�RV_5LPD0 [�CB1 rh
�
[�ICB1TEMP {TEMP�TEMPpTEMP`*GETD [�CB1 rh
�
[�ICB1TEMP �TEMP
 FLCRSRBUF
�   �  y �BUF
BVAL�BUF
BLEN�BUF
IRQNpiBVALpjIRQN��
p
BLEN�BUF!LSTA ��h �
���SYS���GIRQ �
�
` C,._SB_PCI0[�SIRC_HIDA�_STA
_UID
LADDBBUFF
�   y �UFF
ADDR�UFF
LENGp
y `����
�
pjADDR�BUFF`��
piADDR�BUFF`��
pr
i ADDRp�NG�BUFF`�O_CRSp
y
`�ADDBSMD0SB00SB10`�ADDBSMD1SB01SB11`�ADDBSMD2SB02SB12`�ADDBSMD3SB03SB13`�ADDBSMD4SB04SB14`�ADDBSMD5SB05SB15`�ADDBSMD6SB06SB16`�ADDBSMD7SB07SB17`�ADDBSMD8SB08SB18`�ADDBSMD9SB09SB19`�ADDBSMDASB0ASB1A`��^.GPI0_STA
�^^.GPI0_CRS`�[�GPI0%_HID ��CHVSPTH�INT345D �INT344B LINK\_SB.PCI0.GPI0 I
_CRS RBUF2
/�   �   �   �  y �BUF
COM0�BUF
COM1�BUF
COM3�BUF
)IRQNprSBRG � COM0prSBRG � COM1prSBRG � COM3pSGIRIRQN�BUF_STA ��BRG ���PEN
��&._SB_PCI0[�I2C0LINK\_SB.PCI0.I2C0 ��SMD0
C/_SB_PCI0I2C0_HIDINT3442 _HRV �HRVSB10_CRS �CRSSMD0SB00SIR0_PSC
GETDSB10_PS0 LPD0SB10_PS3 LPD3SB10_STA �STASMD0��MD0
2/_SB_PCI0I2C0_ADR 
_DSM�PCICh�CIDhijk�&._SB_PCI0[�I2C1LINK\_SB.PCI0.I2C1 ��SMD1
C/_SB_PCI0I2C1_HIDINT3443 _HRV �HRVSB11_CRS �CRSSMD1SB01SIR1_PSC
GETDSB11_PS0 LPD0SB11_PS3 LPD3SB11_STA �STASMD1��MD1
2/_SB_PCI0I2C1_ADR 
_DSM�PCICh�CIDhijk�&._SB_PCI0[�I2C2LINK\_SB.PCI0.I2C2 ��SMD2
C/_SB_PCI0I2C2_HIDINT3444 _HRV �HRVSB12_CRS �CRSSMD2SB02SIR2_PSC
GETDSB12_PS0 LPD0SB12_PS3 LPD3SB12_STA �STASMD2��MD2
2/_SB_PCI0I2C2_ADR 
_DSM�PCICh�CIDhijk�&._SB_PCI0[�I2C3LINK\_SB.PCI0.I2C3 ��SMD3
C/_SB_PCI0I2C3_HIDINT3445 _HRV �HRVSB13_CRS �CRSSMD3SB03SIR3_PSC
GETDSB13_PS0 LPD0SB13_PS3 LPD3SB13_STA �STASMD3��MD3
2/_SB_PCI0I2C3_ADR 
_DSM�PCICh�CIDhijk�&._SB_PCI0[�I2C4LINK\_SB.PCI0.I2C4 ��SMD4
C/_SB_PCI0I2C4_HIDINT3446 _HRV �HRVSB14_CRS �CRSSMD4SB04SIR4_PSC
GETDSB14_PS0 LPD0SB14_PS3 LPD3SB14_STA �STASMD4��MD4
2/_SB_PCI0I2C4_ADR 
_DSM�PCICh�CIDhijk�&._SB_PCI0[�I2C5LINK\_SB.PCI0.I2C5 ��SMD5
C/_SB_PCI0I2C5_HIDINT3447 _HRV �HRVSB15_CRS �CRSSMD5SB05SIR5_PSC
GETDSB15_PS0 LPD0SB15_PS3 LPD3SB15_STA �STASMD5��MD5
2/_SB_PCI0I2C5_ADR  _DSM�PCICh�CIDhijk�._SB_PCI0[�SPI0��SMD6
C/_SB_PCI0SPI0_HIDINT3440 _HRV �HRVSB16_CRS �CRSSMD6SB06SIR6_PSC
GETDSB16_PS0 LPD0SB16_PS3 LPD3SB16_STA �STASMD6��MD6
2/_SB_PCI0SPI0_ADR  _DSM�PCICh�CIDhijk�._SB_PCI0[�SPI1��SMD7
C/_SB_PCI0SPI1_HIDINT3441 _HRV �HRVSB17_CRS �CRSSMD7SB07SIR7_PSC
GETDSB17_PS0 LPD0SB17_PS3 LPD3SB17_STA �STASMD7��MD7
2/_SB_PCI0SPI1_ADR  _DSM�PCICh�CIDhijk�._SB_PCI0[�UA00��SMD8
D/_SB_PCI0UA00"_HID ��SMD9
�INT3448 ��A�_UIDSerialIoUart0 _DDNSerialIoUart0 _HRV �HRVSB18_CRS
�CRSSMD8SB08SIR8_PSC GETDSB18_PS0 ��SMD8
LPD0SB18_PS3 ��SMD8
LPD3SB18_STA �STASMD8��MD8
2/_SB_PCI0UA00_ADR  _DSM�PCICh�CIDhijk�._SB_PCI0[�UA01��SMD9
D/_SB_PCI0UA01"_HID ��SMD9
�INT3449 ��A�_UIDSerialIoUart1 _DDNSerialIoUart1 _HRV �HRVSB19_CRS
�CRSSMD9SB09SIR9_PSC GETDSB19_PS0 ��SMD9
LPD0SB19_PS3 ��SMD9
LPD3SB19_STA �STASMD9��MD9
2/_SB_PCI0UA01_ADR  _DSM�PCICh�CIDhijk�._SB_PCI0[�UA02��SMDA
D/_SB_PCI0UA02"_HID ��SMDA
�INT344A ��A�_UIDSerialIoUart2 _DDNSerialIoUart2 _HRV �HRVSB1A_CRS
�CRSSMDASB0ASIRA_PSC GETDSB1A_PS0 ��SMDA
LPD0SB1A_PS3 ��SMDA
LPD3SB1A_STA �STASMDA��MDA
2/_SB_PCI0UA02_ADR  _DSM�PCICh�CIDhijk�D ._SB_PCI0HIDG
�gBUE��=��TP7G
��Q���K)HIDD��HIDG�� ������� ,TP7D��TP7G�� ������lm �
D?/_SB_PCI0I2C0[�$TPD0HID2 SBFB&
#�    � \_SB.PCI0.I2C0 y SBFI
�  y SBFG-
*�      ( \_SB.PCI0.GPI0 y �BFB
BADR�BFB
SPED�BFG
INT1�BFI
INT2J_INI ��SYS�SRXOGPDIpGNUMGPDIINT1pINUMGPDIINT2��DM0
SHPOGPDI��DS0pSYNA2393 _HIDp
 HID2���DS0
p06CB2846 _HIDp
 HID2���DS0
pCUST0001 _HIDpTPDHHID2pTPDBBADR��PDS p� SPED��PDSp� SPED��PDS
p@B SPED�_HIDXXXX0000 _CIDPNP0C50 _S0W
9_DSM��HIDG�IDDhijkHID2��TP7G�P7DhijkSBFBSBFG� #_STA ��SDS0
�SDS0�DS0
��3_CRS ��SYS��BFI��DM0 �SBFBSBFG �SBFBSBFI [�HDAC_HIDINT0000 _CIDINT0000
_DDNIntel(R) Smart Sound Technology Audio Codec _UIDCADR @ _INI
��2SCpINT3439 _HIDpINT3439 _CIDp
CADR���2SC
pINT343A _HIDpINT343A _CIDp
CADR���2SC
pINT343B _HIDpINT343B _CIDp
4CADR�M_CRS SBFB&
#�    � \_SB.PCI0.I2C0 y SBFI
�  y �BFB
ADR_pCADRADR_�BFI
AINTpINUM AINT��ID_
 �BFB�SBFBSBFI _STA ��I2SC ��A8/_SB_PCI0I2C1[�/TPL1HID2 SBFB&
#�    � L \_SB.PCI0.I2C1 y SBFG-
*�      ( \_SB.PCI0.GPI0 y SBFI
�  y �BFB
BADR�BFB
SPED�BFI
INT2�BFG
INT1M_INI ��SYS�SRXOGPLIpGNUMGPLIINT1pINUMGPLIINT2��DM1
SHPOGPLI��DS1pATML3432 _HIDp HID2p
LBADRp� SPED���DS1
pATML2952 _HIDp HID2p
JBADRp� SPED���DS1
pELAN2097 _HIDpHID2p
BADRp� SPED���DS1
pNTRG0001 _HIDpHID2p
BADRp� SPED���DS1
pNTRG0002 _HIDpHID2p
dBADRp� SPED���DS1
pCUST0000 _HIDpTPLHHID2pTPLBBADR��PLS p� SPED��PLSp� SPED��PLS
p@B SPED�_HIDXXXX0000 _CIDPNP0C50 _S0W
9_DSM��HIDG�IDDhijkHID2��TP7G�P7DhijkSBFBSBFG� _STA ��SDS1 ��3_CRS
��SYS��BFI��DM1 �SBFBSBFG �SBFBSBFI [�IMP3_ADR _HIDIMPJ0003 _CIDIMPJ0003
_UID_STA ��ID_
 ��7_CRS SBUF&
#�    � n \_SB.PCI0.I2C1 y �BUFK;/_SB_PCI0SPI1[�:FPNTF_HID
��DS7�FPC1011 ��DS7
�FPC1020 ��DS7
�VFSI6101 ��DS7
�VFSI7500 ��DS7
�EGIS0300 ��DS7
�FPC1021 �FPNT_DIS _INI SHPOGFPISHPOGFPS_STA ��SDS7 ��M._CRS_T_0
BBUFB
N�    �� \_SB.PCI0.SPI1 �     (  \_SB.PCI0.GPI0 y IBUF
�  y GBUF-
*�      ( \_SB.PCI0.GPI0 y UBUF-
*�     ( \_SB.PCI0.GPI0 y �BUF
SPEX�BUF
PHAX�BUF
;SPIN�BUF
GPIN�BUF
IPIN�BUF
ILVL�BUF
ITRG[GBUF
9
GLVL�BUF
8GTRG�BUF
9SCSP�BUF
UPINpGNUMGFPSSPINpGNUMGFPIGPINpINUMGFPIIPINpGNUMGFPIUPIN��SDS7
�DS7
p ILVLpITRGp GLVLpGTRG��DS7
p ILVLpITRG�pSDS7_T_0��T_0p��SPEXp PHAX���T_0
p�- SPEXp PHAX���T_0
p z SPEXpPHAX���T_0
p z SPEXp PHAX���T_0
p $�EXp PHAX���T_0
p�- SPEXp PHAX���DS7�BUF��SDS7
�DM7 �BBUF�BUFGBUF ��SDS7
�SDM7 �BBUF�BUFIBUF ��DM7 �BBUFGBUF �BBUFIBUF K&/_SB_PCI0UA00[�%BTH05_HID
��DS8�INT33E1 ��DS8
�BCM2E40 �INT33E1 !_INI SHPOGBTISHPOGBTWSHPOGBTKN_CRS SBFGC

�"  5 
 � �_SB.PCI0.UA00 �     ( \_SB.PCI0.GPI0 �     ( \_SB.PCI0.GPI0 �  
    ( \_SB.PCI0.GPI0 y �BFG
�NT3�BFG
<WAK3�BFG
dKIL3pGNUMGBTIINT3pGNUMGBTWWAK3pGNUMGBTKKIL3SBFID
�"  5 
 � �_SB.PCI0.UA00 �     ( \_SB.PCI0.GPI0 �     ( \_SB.PCI0.GPI0 �  y
 �BFI
zINT4�BFI
<WAK4�BFI
dKIL4pINUMGBTIINT4pGNUMGBTWWAK4pGNUMGBTKKIL4��DM8 �BFG��BFI_STA ��SDS8 ��_S0W
B._SB_PCI0[�GNSS_HIDINT33A2 L _CRS BUF1*
'�  5 
 � @ @ �_SB.PCI0.UA01 y BUF2-
*�     ( \_SB.PCI0.GPI0 y �UF2
RPINpGNUMGGNRRPIN��NSC�BUF1BUF2 ��UF2_STA ��NSC
��Nm._SB_PCI0[�mGEXP_ADR_STA
SGEPCSERGEXNhij SGEDCSERGEXNhijGEPS
�SERGEXNhi
SGEICSERGEXNhij
;INVC p `��
��3DC `
W3DC ` ��3DC`
W3DC` r``PPR_
INR_ 
OUTR


CFGR


POLR



EXPA
"UCCHEND_ READ CACHCG   
    
    
    
 G   
    
    
    
 W3DCpk���ACHh i j R3DC����ACHh i j BWREG[�AR0 h[�BAR0ICON TAR_
@DATA HCNT LCNT @ ABRT J RBCK @CLR_ @
ENB_ ACTVTFNF RFNE LHOLD @ENSB O�ST_ pr[3P�ap
RST_p ENB_pRBCK`pCLR_`p  HOLDpHCNTp�LCNTprEXPAi TAR_p
eICONpENB_��ENSB��3a�pjDATAprEND_k DATA��ACTV ��3a�p ENB_��ENSB
��3a�W3DCijk��3DCij W3DCij
�KRREG��CCH��3DCij
�3DCij[�AR0 h[�BAR0ICON TAR_ @DATA HCNT LCNT @ ABRT J RBCK @CLR_ @
ENB_ ACTVTFNF RFNE LHOLD @ENSB O�ST_ pr[3P�ap
RST_p ENB_pRBCK`pCLR_`p  HOLDpHCNTp�LCNTprEXPAi TAR_p
eICONpENB_��ENSB��3a�pjDATAprEND_READ DATA��ACTV ��3a�pDATA`p ENB_��ENSB
��3a��,PS0_ [�AR1 h
��BAR1 @BD0D3p D0D3pD0D3`-PS3_ [�AR1 h
��BAR1 @BD0D3p
D0D3pD0D3`E CSERSB1X SB0X SMDX PINN REGN REGA OLDV NEWV RETV ��
��� pSB10SB1XpSB00SB0XpSMD0SMDX��pSB11SB1XpSB01SB0XpSMD1SMDX��
pSB12SB1XpSB02SB0XpSMD2SMDX��
pSB13SB1XpSB03SB0XpSMD3SMDX��
pSB14SB1XpSB04SB0XpSMD4SMDX��
pSB15SB1XpSB05SB0XpSMD5SMDX��
������
������
���SMDX
��� pOUTR`��pCFGR`��
pINR_`��
pPOLR`PS0_SB1XxjPPR_PINNREGNp�`REGN REGApRREGSB0XiREGAOLDV��
p{zOLDVPINN RETV�{OLDV�PINN NEWV}ykPINN
NEWVNEWV��NEWVOLDVWREGSB0XiREGANEWVPS3_SB1X�ETVPKG1 PKG_ ph�KG_
�KG_2PKG3PKG_ ph�KG_ pi�KG_ pj�KG_
 �KG_�USTPH/_SB_PCI0I2C1SSCN �KG3SSHISSLISSDIFMCN �KG3FMHIFMLIFMDIFPCN
�KG3FPHIFPLIFPDIM0D3 �KG1M0CIM1D3 �KG1M1CI//_SB_PCI0SPI1M0D3
�KG1M0CSM1D3 �KG1M1CS//_SB_PCI0UA01M0D3 �KG1M0CUM1D3
�KG1M1CU�)�CHVSPTLA)._SB_PCI0[�PEMC_ADR  [�CSR  [�SCSR @BPSTA @
PGENA_PS0p PGENPCRA
� ��
PCRO
� E �PSTA�PSTApPSTA`_PS3pPGEN}PSTA
PSTApPSTA`B
_DSM_T_0 �PCICh�CIDhijkADBGsEMH4= �MH4 ��
���F�)�a�� �pj_T_0��T_0 ��MH4�a�!���T_0
����T_0
��� �� [�CARD_ADR
_RMV �[�PSDC_ADR  [�CSR  [�SCSR @BPSTA @ PGEN>_PS0p PGENPCRA
� z�"
PCRO
� �{PSTA�PSTApPSTA`_PS3pPGEN}PSTA
PSTApPSTA`I_DSM_T_0 �PCICh�CIDhijk��
���F�)�a�� �pj_T_0��T_0 ����T_0
["
d� ���T_0
["
d� �� �� [�CARD_ADR
_RMV �2._SB_PCI0[�ISHD_ADR  _DSM�PCICh�CIDhijk2._SB_PCI0[�HECI_ADR 
_DSM�PCICh�CIDhijk�/_SB_PCI0LPCB[�EC0__HIDA� _UIDECAV [LFCM _GPE
pGGPE `�&_CRS BFFR
Gb b Gf f y �FFR _STA �[�RAM
�ERAMVCMD[�MMP  ���MERAM VDATVSTA
FANSBUSGBLEGBATFBNSMBTSTBBADAUTOFCHGABTLDBTLEDCCALSCCDMBCCSBBTSMBTCMLBTMCSBMSGSTHDMIHYBDSWSTEVNTDCRFCOLRSGCNODPOEODDODPKCMEXCMONSODDODFBEODSRTMPVTMPAFCCPINFSUPRGTMPQUITLS35
RMBTRSBTVTYP FUSLFUSHFWBT@ HECTP 0ESMC EMODBFUD
HEXSIEXSBEXNDSMPRSMSTSMADSMCMSMDA@BCNTSMAASAD0SAD1 KBLOUCHEKLCH
KLFSKLORUCHRUCERTPDV ECHG BMN0HBDN0@IBTLIBCLISS0IRTCISUPISC2IWAK
 VOUTTPADHKDB  OSTY ADPI
ADPTPMEWMODWLANWRTCWWLAWUSBWKEYWTPWKCHCRADPPLERNACMDBOVPLEAKAIRPACOFS3ENS3RSS4ENS4RSS5ENS5RS
OSTTOSSTTHRTTCOTMODE INITFAN1FAN2FAOKSKINSDTESPDNFNUMTLVL
THSWTPINTSTHTSCP PLVLCPUTCPTL ( PWDBDIGTCDLK 
LSTEPMEEPWBERNGEBTWE LCBVAOACS35FIFFSINS0ISBLISOV
ISRTWLANBLUEWEXTBEXTKILLWLOKEN3GEX3GKPIDCTYPCOREGATYBA1PBA2P
B1CHB2CH PBY1PBY2 SMB1SMB2 B1TYB1MDB1LW B1MF
B1STB1RCB1SNB1FVB1DVB1DCB1FCB1GSB1CTB1CRB1ACB1PCB1VLB1TMB1ATB1CCB1TCB1CIB1CUB1CAB1SMB1VCB1FAB1VAB1C1B1C2B1C3B1C4
(B1EXB1FLB1EPB1FI B1RE B1LLB1CEB1SEB1S5B1SRB1SC
B1TOB1BCB1CFB1CSB1SGB1SUB1OVB1OTB1TTB1SAB1SS B1SFB1WN B1DA B1CN
[�MDE
h
[�CMDEEC68   EC6C)WIBEp  `�`pEC6Ca��a
 �[!

v`�(WOBFp  `�`pEC6Ca��a �[!

v`�0WOBEp  `�`pEC6Ca��a pEC68b��[!

v`�FLCMD
LBUF
 ��IBE���OBE�phEC6C��IBE���� �i
�C68��IBE���OBF�pEC68`p a�`��OBF�pEC68�BUFa uav`�BUFKLRAM
��IBE���OBE�p
~EC6C��IBE�phEC68��IBE�piEC68��IBE���OBF��C68[�@BAT0_HIDA�
_UID_PCL_SB_PBIF8 ���
d LCFC BAT20101001 LiP LENOVO PBST� 0*;_STA ��CON��#LFCM
�pBA1P`['LFCM�{` ������@_BIF ��CON��#LFCM �pB1DC`w`

`p`�BIF pB1FC`w`

`p`�BIF
 pB1DV�BIF
 �B1FCpxwB1FC



 �BIF
 pxwB1FC


 �BIF
 pxwB1DC


d �BIF
 p �BIF
	 p �BIF

 p �BIF
 p �BIF
 BDNT
	 pBDN0BDNTp�DNT�BIF
	 pB1SN`SERN
 p
b�`x`

a`ra
0�ERNb vbpSERN�BIF

 DCH0

 DCH1LION DCH2LiP ��1TYpDCH1DCH0p�CH0�BIF
 �pDCH2DCH0p�CH0�BIF
 BMNT

 pBMN0BMNTp�MNT�BIF
 ['LFCM�BIFOBST OBAC OBPR OBRC OBPV E_BST_T_0 ��CON��#LFCM
�pB1ST`��B1ST`pB1ST`p�PBST a�p{`
 _T_0��T_0 p{a
�ST���T_0p}{a
�BST���T_0
p}
{a
�BST���T_0
p}
{a
�BST�B1ACOBAC��B1ACOBACpB1ACOBAC�{OBST ��OBAC p{�BAC
�BACpB1RCOBRCpB1FVOBPV���1RCOBRC�B1FVOBPVpB1RCOBRCpB1FVOBPVwOBRC

OBRCpxwOBACOBPV � OBPRpOBST�BST pOBPR�BST pOBRC�BST
 pOBPV�BST
 ['LFCM�BST@�/_SB_PCI0LPCBEC0_[��PC0_HIDVPC2004 _UID _VPC�VPCD  _STA
�?_CFG p_VPC`{`�`��EXT}`  `��EXT}`  `p`_VPC�VPC6VPCR ��#LFCM
���pVCMDVPCD�pVDATVPCD['LFCM�PCD-VPCW
��#LFCM ���piVCMD�piVDAT['LFCM�SVCR LHALS p `��#LFCM �}`
`��KBLO}`
 `}`
@`��UCHE}`
�}` `��KDB}` `}` `['LFCM�MSALS p� `��#LFCM ���
pKBLOpKLCH['LFCM���
	p KBLOpKLCH['LFCM���

pUCHEp
2SMIDp
�MIC['LFCM���
p UCHEp
3SMIDp
�MIC['LFCM���
p HKDBp
0SMIDp
�MIC['LFCM���
pHKDBp
1SMIDp
�MIC['LFCM�['LFCM�DGBMD p `��#LFCM ���CDMB}``��ECHG}`
`��BBAD}`
`��BTSM}`
 `��BLEG}`
���BATF}` `��BTSM}` `��BUSG}` `��ADPI{`�`��ADPI}` ���ADPI}`  `}` 
`}`  `}`  `��ESMC}` @ `['LFCM�VBST VBAC VBPR VBRC VBPV VBFC VBCT
GSMTF��#LFCM ��
� ��1FV ['LFCM���1AC ['LFCM��1FC`w`

`p`VBFCpB1RCawa

apaVBRC��BFCVBRCpB1FVVBPVpB1ACVBACt`a`pwVBACVBPV apw`�cpwc
< cpxca VBCT['LFCM�BCT�['LFCM���['LFCM��LFCM��BST QBAC QBPR QBRC QBPV
QBFC QBCT @SMTE��#LFCM ��� ��1FV ['LFCM���1AC ['LFCM��1RC`w`

`p`QBRCpB1FCawa

apaQBFC��BFCQBRCpB1FVQBPV��B1AC � pB1ACQBAC�pt�AC QBACpwQBACQBPV apw`�cpwc
< cpxca QBCT['LFCM�BCT�['LFCM���['LFCM��LFCM��SBMC��#LFCM ��� p
CDMBpEDCC['LFCM���pCDMB['LFCM���
pBTSM['LFCM���
p BTSM['LFCM���
pECHG['LFCM���
p ECHG['LFCM���
	pESMC['LFCM���
p ESMC['LFCM�['LFCM�8MHCFp
xP80Hph`��#LFCM �{`
 `z`
`p`RMBT["
['LFCM�AMHPF��#LFCM �BFWB
%�FWB FB0_�FWBFB1_�FWB
FB2_�FWB
FB3_[BFWB
  FB4_�FWB
$FB5_���
%��SMPR pSMSTFB1_�
phBFWBpFB2_SMADpFB3_SMCMpFB5_BCNTpFB0_`��` pFB4_SMDAp
SMSTpFB0_SMPRp��a["va��SMST
�SMPR �FB0_`��{` pSMDAFB4_pSMSTFB1_��a �SMST
� SMPRp
�B1_['LFCM�FWB['LFCMCMHIF��#LFCM �p
PP80H�� RETB

BUF1
pFWBTBUF1�UF1 FW0_�UF1FW1_�UF1
FW2_�UF1
FW3_�UF1
FW4_�UF1
FW5_�UF1
FW6_�UF1
FW7_pFUSL�ETB pFUSH�ETB pFW0_�ETB
 pFW1_�ETB
 pFW2_�ETB
 pFW3_�ETB
 pFW4_�ETB
 pFW5_�ETB
 pFW6_�ETB
 pFW7_�ETB
	 ['LFCM�ETB['LFCMA+GSBIBIFBG
S���������������������BIFB DCAP�IFB
FCAP�IFB
RCAP�IFB
ATTE�IFB
ATTF�IFB

BTVT�IFB
BTCT�IFB
BTMP�IFB
MDAT�IFB
FUDT�IFB
DVLT[BIFB
�PDCHE[BIFB 
@DNAM[BIFB@
`MNAM[BIFB�
�RNB�IFB
KBFW0��h ���CON��#LFCM �pB1DC`w`

`p`DCAPpB1FC`w`

`p`FCAPpB1RC`w`

`p`RCAPpSMTE ATTEpSMTF ATTFpB1FVBTVTpB1ACBTCTpB1AT`r``w`

`p`BTMPpB1DAMDAT��BFUD pBFUDFUDTpB1DVDVLTDCH0

 DCH1LION DCH2LiP ��1TYpDCH1DCH0pDCH0DCHE�pDCH2DCH0pDCH0DCHEBDNT
 pBDN0BDNTpBDNTDNAMBMNT
 pBMN0BMNTpBMNTMNAMBRN0
 p
ap
)b�apLRAM
b�RN0t
a ubvapBRN0BRNBpFWBTBFW0['LFCM�IFB��
�IFB�HODD SODD LGBIDGBUF&
 
 
 
 ��#LFCM �pB1CT��BUF p ��BUF BUF1
pFWBTBUF1�UF1 FW0_�UF1FW1_�UF1
FW2_�UF1
FW3_�UF1
FW4_�UF1
FW5_�UF1
FW6_�UF1
FW7_pFW0_��BUF
 pFW1_��BUF
  pFW2_��BUF

 pFW3_��BUF

 pFW4_��BUF

 pFW5_��BUF

 pFW6_��BUF

 pFW7_��BUF

 p ��BUF
 ['LFCM�BUFAPDT APPC phAPDT�)DBSL �!
���~
i
V
E
6
)





 6SBSL ��#LFCM �ph`��p
LCBV��
p
LCBV['LFCM�STHT �D\ [�FCN �� [�LFCNPS2VKBIDMCSZEDID@@LFCO@2[�MIO
�[�SMIOSMICSMIDBCL7
P
2




(
2
<
F
P
Z
dK_REG��h
�pECAVp `��SYS�`��SYS�p
`��SYS�p
`��SYS�p
`��SYS�p
`��OSYS�p
`��#LFCM �p`OSTYpECON��STE p ^^^.GFX0CLID��STEp
^^^.GFX0CLIDpLSTELIDSp
PLVL['LFCMCMFC�DIDBLTB






"
2
F
d?BSYC ��SYS�p `{^^^.GFX0CBLV
��`

���BLTB` �`p`LCBVL _Q11 p
P80H��SYS���CBV

p

LCBV{^^^.GFX0CBLV
��`�BLTBLCBV BSYC�^^.GFX0DD1F
�9�SYS����^^.GFX0CADL �^^^.GFX0CAL2 ��CBV vLCBV�PC0
�L _Q12 p
P80H��SYS���CBV

p LCBV{^^^.GFX0CBLV
��`�BLTBLCBV BSYC�^^.GFX0DD1F
�:�SYS����^^.GFX0CADL �^^^.GFX0CAL2 ��CBV

uLCBV�PC0
�1_Q15 p
P80H�S2M
pLIDS^^^.GFX0GLIDLIDS�ID0
�1_Q16 p
P80H�S2M
p LIDS^^^.GFX0GLIDLIDS�ID0
�_Q1C p
P80H5_Q1D p
P80H��#LFCM �pTLVL`['LFCMp`\._PR_CPPCPNOT"_Q25 p
%P80H�DP0
�BAT0
�BAT0
�*_Q37 [",p
7P80HpPWRS�DP0
�BAT0
�NOT*_Q38 [",p
8P80Hp PWRS�DP0
�BAT0
�NOT_Q32 p
2P80H�WRB
�_Q3E p
>P80H�S2M
>_Q3F p
?P80H�S2M
?_Q44 p
DP80H�PC0
�N_Q65 ��SYS���LAN SGOV  �SGOV ��LUE SGOV  �SGOV \ GPSF
DCPS DGST
�B_Q62 ��#LFCM ���ATY
pDCPS��DGST
�
bP80Hp
�GST�^^.PEG0PEGP
�"

��PSFp GPSF�^^.PEG0PEGP
�'LFCMB_Q63 ��#LFCM ���ATY
p DCPS��DGST
�
cP80Hp
�GST�^^.PEG0PEGP
�"

��PSF pGPSF�^^.PEG0PEGP
�'LFCMC_Q85 ��#LFCM ���ATY
pDCPS��DGST
�
�80Hp
�GST�^^.PEG0PEGP
�"

��PSFp GPSF�^^.PEG0PEGP
�
\._PR_CPPCPNOT['LFCMC_Q84 ��#LFCM ���ATY
pDCPS��DGST
�
�80Hp
�GST�^^.PEG0PEGP
�"

��PSFp GPSF�^^.PEG0PEGP
�

\._PR_CPPCPNOT['LFCMB_Q83 ��#LFCM ���ATY
pDCPS��DGST
�
�80Hp
�GST�^^.PEG0PEGP
�"

��PSFp GPSF�^^.PEG0PEGP
�\._PR_CPPCPNOT['LFCMB_Q82 ��#LFCM ���ATY
pDCPS��DGST
�
�80Hp
�GST�^^.PEG0PEGP
�"

��PSFp GPSF�^^.PEG0PEGP
�\._PR_CPPCPNOT['LFCMB_Q81 ��#LFCM ���ATY
p DCPS��DGST
�
�80Hp
�GST�^^.PEG0PEGP
�"

��PSF pGPSF�^^.PEG0PEGP
� \._PR_CPPCPNOT['LFCM@[\_SB_[�ADP0_HIDACPI0003 _STA ��CON��O_PSR
��#^^/PCI0LPCBEC0_LFCM ��^/PCI0LPCBEC0_ADPT['^^/PCI0LPCBEC0_LFCM_PCL
�_SB_[�LID0_HIDA�_STA ��CON��_LID �IDS[�PWRB_HIDA�_STA
��CON��[�LWMI4_HIDA�_UID
[MWMI _WDG+
(v7�����?<AD!�f�� �)BD ITEM< BAT0 BatMaker  BAT0 HwId 
BAT0 MfgDate EWQAD��#^^/PCI0LPCBEC0_LFCM �pPSAGh`p�ITEM` ap�a bp�a cp�a
 dpBATDbcesd, fsfeg['^^/PCI0LPCBEC0_LFCM�PSAG�FBATDSTRB

 BUFR
p^^/PCI0LPCBEC0_FWBTBUFR�UFR MID0�UFR
HID0�UFR
FIR0�UFR
DAT0�� �� p�ID0 STRB��p�ID0 STRB�
�
p^^/PCI0LPCBEC0_B1DA`DATB
	00000000 p
cp{`
 a�axa

barb
0�ATBc vcp
cpz{`�
 a�axa

barb
0�ATBc vcp
cprz{` � � a�axa

barb
0�ATBc vcpDATBSTRB�STRB�QBDJ'uFOMB e �DS }�т
B�!�P�A��!�p.@��"�������:
S�ND���Bh���[����%f(��`����"B��4OL����X�*���l���Ip�Z��9��H&m(�{Z'�<(��'(B�<
ϱx�L�#��G.�C万�?`��v�B���@ɀ�Va5��tvХ!Fo��
k��6��!↬E�5P��H�w�O����p��L@.
��2�z�@�8���]|�P�:`����3���TfO:M� �$���z����������� �$�yp<��G
~��]�q8g�*�\���� ��� ;$xG��'<>�����`WhӧF��(ӠV����{!�X
4���FWHD_HID%� _CRS
� �y [�HPET_HIDA�_UID BUF0
�  �  y _STA �HPTE��%_CRS�HPTE�UF0
HPT0pHPTBHPT0�UF0[�
IPIC_HIDA�_CRSA
� G$ $ G( ( G, , G0 0 G4 4 G8 8 G< <
G��G��G��G��G��G��G��G��G��" y
[�MATH_HIDA�_CRS
G�" y _STA ��CHVSPTH���[�
LDRC_HIDA�_UID
_CRSF
�.  . GN N Ga a Gc c Ge e Gg g Gp p G��G��G��G��
G�G�G�G  �Ny [�LDR2_HIDA�_UID
_CRS

G  � _STA ��CHVSPTH���[�RTC__HIDA� _CRS
Gp p " y [�TIMR_HIDA� _CRS
G@ @ GP P " y [�CWDT_HID%�_CIDA�BUF0

GTTy  _STA�_CRS�UF0[�KBS
`
[�PKBSPKBD   PKBC[�PS2K_HIDMSFT0001 _CIDA� _STA �_CRS
G` ` Gd d # y _PRS
1 K` Kd " 8y [�PS2MD_HID_T_1 _T_0 ��GIV �p�S2V _T_0��T_0�ETD063D
���T_0
�SYN2B5B ���T_0
�AUI1635 ��FFFFFFF �J�p�S2V _T_1��T_1�ETD0645 ���T_1
�SYN2B5D ���T_1
�AUI1637 ��FFFFFFF �@_CID_T_1 _T_0 ��GIV �p�S2V _T_0��T_0�
A��)��T_0
�A����T_0
�A������p�S2V _T_1��T_1�
A��)��T_1
�A����T_1
�A�����TPRDp
.P80H�^.EC0_ECTPTPWR p
/P80Hph^^.EC0_ECTP _STA �_CRS
# y _PRS
1 " 8y ECUP[EHLD N \ [� CHUB_HID%��_STA ��HEN��C_DSM_T_1 _T_0
��
��4J�Mv���� �p� _T_0��T_0 ����T_0�p�k _T_1��T_1 ����A_SB_[�TSS 
1�[�ITSSPARCPBRCPCRCPDRCPERCPFRCPGRCPHRC @�SCGE[MUTX [OSUM
[WFEVH2OEP8XE PFDP
��RTDPFDP
[�PRTDH2OD H2OP ��H2OE phH2OD[�RT0
�[�PRT0P80H GP8XH
�� p}{P80D �i P80D��p}{P80D� yi
 P80D��
p}{P80D� yi
 P80D��
p}{P80D� yi
 P80D��P8XE pP80DP80H[�PRT
�[�SPRTSSMP_PICphGPICphPICMLIDX G_PTSp P80DP8XH h��H2OP
Q��
H2OP
S��
H2OP
T��
H2OP
UADBGs_PTS= � ��BTS[&WFEV��
�[\._PR_DTSE ��._PR_DTSE�CNTTRAP

��BGS �[\/_SB_TPM_PTS_ \/_SB_TPM_PTS_h���
�
�
��FLV
\._SB_SGOV ��
p\/_SB_PCI0LPCBEC0_LSTELIDXLZ_WAK P8XH
�
�H2OP
��
H2OP
��
H2OP
��
H2OP
�BG_WAK \/_SB_PCI0GEXPINVC��0IDp\._SB_SCGE�NEXP�{OSCC
 \/_SB_PCI0NHPG�{OSCC
 \/_SB_PCI0NPME��
\/_SB_PCI0LPCBEC0__REG
��
��ACTT��CON�K�h
�
��CON��
p\/_SB_PCI0LPCBEC0_LSTELIDS��LIDXLIDS�IGDS��IDS p
�/_SB_PCI0GFX0CLID��IDSp �/_SB_PCI0GFX0CLID�._SB_LID0
�LIDSLIDX��
p\/_SB_PCI0LPCBEC0_LSTELIDS�IGDS��IDS p �/_SB_PCI0GFX0CLID��IDSp
�/_SB_PCI0GFX0CLID�._SB_LID0
�,�\/_SB_PCI0RP01VDID��/_SB_PCI0RP01 ��\/_SB_PCI0RP02VDID��/_SB_PCI0RP02
��\/_SB_PCI0RP03VDID��/_SB_PCI0RP03 ��\/_SB_PCI0RP04VDID��/_SB_PCI0RP04
��\/_SB_PCI0RP05VDID��/_SB_PCI0RP05 ��\/_SB_PCI0RP06VDID��/_SB_PCI0RP06
��\/_SB_PCI0RP07VDID���STS �/_SB_PCI0RP07 ��\/_SB_PCI0RP08VDID���STS
�/_SB_PCI0RP08 ��\/_SB_PCI0RP09VDID��/_SB_PCI0RP09
��\/_SB_PCI0RP10VDID��/_SB_PCI0RP10 ��\/_SB_PCI0RP11VDID��/_SB_PCI0RP11
��\/_SB_PCI0RP12VDID��/_SB_PCI0RP12 ��\/_SB_PCI0RP13VDID��/_SB_PCI0RP13
��\/_SB_PCI0RP14VDID��/_SB_PCI0RP14 ��\/_SB_PCI0RP15VDID��/_SB_PCI0RP15
��\/_SB_PCI0RP16VDID��/_SB_PCI0RP16 ��\/_SB_PCI0RP17VDID��/_SB_PCI0RP17
��\/_SB_PCI0RP18VDID��/_SB_PCI0RP18 ��\/_SB_PCI0RP19VDID��/_SB_PCI0RP19
��\/_SB_PCI0RP20VDID��/_SB_PCI0RP20 ��h
�
��BTS[$WFEV� GETBwh
`wi
a[j`aTBF3�BF3OPNOT��CNT�{PDC0
 �._PR_CPU0
�{PDC1
 �._PR_CPU1
�{PDC2
 �._PR_CPU2
�{PDC3
 �._PR_CPU3
�{PDC4
 �._PR_CPU4
�{PDC5
 �._PR_CPU5
�{PDC6
 �._PR_CPU6
�{PDC7
 �._PR_CPU7
��._PR_CPU0
�H�CNT��PDC0
 {PDC0
 �._PR_CPU0
��PDC1
 {PDC1
 �._PR_CPU1
��PDC2
 {PDC2
 �._PR_CPU2
��PDC3
 {PDC3
 �._PR_CPU3
��PDC4
 {PDC4
 �._PR_CPU4
��PDC5
 {PDC5
 �._PR_CPU5
��PDC6
 {PDC6
 �._PR_CPU6
��PDC7
 {PDC7
 �._PR_CPU7
��._PR_CPU0
��BAR r\/_SB_PCI0GMHB P  [�MBAR �PWRU L3PPL1PL1ECLP1CLMP PLEN PLSV
�CSEM GSPL1PPUU ��SEM�pCSEMpPPL1PLSVpPL1EPLENpCLP1CLMP��WRU pPPUU�yvPWRU
PPUUwPLVLPPUU`x`�apaPPL1pPL1EpCLP1'RPL1pPLSVPPL1pPLENPL1EpCLMPCLP1p
CSEMUAMS GLCK F#GUAM _T_0 ��SYS�rPWRV
�BGLoc 0 ADBG`[�CTC `
[�ACTC ACTD�p� _T_0��T_0 ��LCKp GLCKP8XH
�8XH
�DBGExit CS ��CNOADBGEC Notify p[#EHLD�� ��CLPpECUP['EHLD��CDBADBGEC Debug
��OSYS�p ACTD�PSCP�[\/_PR_CPU0_PPC p \._PR_CPPCPNOT�PLCSRPL1���T_0��LCK
pGLCKP8XH
�8XH ADBGEnter CS ��CNOADBGEC Notify ��CDBADBGEC Debug ��CLPp
ECUP��OSYS�pACTD�PSCP��\/_PR_CPU0_PSS [\/_PR_CPU0_PPC �{PDC0 
t�/_PR_CPU0TPSS\._PR_CPPC�t�/_PR_CPU0LPSS\._PR_CPPCPNOT�PLCSSPL1�����WRSUAMSP_CSGP_CS�[\/_SB_PCI0PAUDPUAM
\/_SB_PCI0PAUDPUAM��SYS��[\/_SB_PCI0XHC_DUAM \/_SB_PCI0XHC_DUAM\ [�O_H 
[�IO_HTRPHITRAP
piSMIF��
pi\._PR_DTSFp \._PR_TRPD�._PR_DTSF��
p TRPH��
p \._PR_TRPF�MIFAW._SB_PCI0PTMA �._PR_BGMAPTMS �._PR_BGMSPTIA
�._PR_BGIAO_INIp�OSYS�[\_OSI`�_OSILinux p�SYS�_OSIWindows 2001
p�OSYS�_OSIWindows 2001 SP1 p�OSYS�_OSIWindows 2001 SP2 p�OSYS�_OSIWindows
2001.1 p�OSYS�_OSIWindows 2006 p�OSYS�_OSIWindows 2009 p�OSYS�_OSIWindows 2012
p�OSYS�_OSIWindows 2013 p�OSYS�_OSIWindows 2015 p�OSYS�[\._PR_DTSE
��\._PR_DTSEp\._PR_DSAEGNHPGp ^.RP01HPEXp ^.RP02HPEXp ^.RP03HPEXp ^.RP04HPEXp
^.RP05HPEXp ^.RP06HPEXp ^.RP07HPEXp ^.RP08HPEXp ^.RP09HPEXp ^.RP10HPEXp
^.RP11HPEXp ^.RP12HPEXp ^.RP13HPEXp ^.RP14HPEXp ^.RP15HPEXp ^.RP16HPEXp
^.RP17HPEXp ^.RP18HPEXp ^.RP19HPEXp
^.RP20HPEXp^.RP01HPSXp^.RP02HPSXp^.RP03HPSXp^.RP04HPSXp^.RP05HPSXp^.RP06HPSXp^.RP07HPSXp^.RP08HPSXp^.RP09HPSXp^.RP10HPSXp^.RP11HPSXp^.RP12HPSXp^.RP13HPSXp^.RP14HPSXp^.RP15HPSXp^.RP16HPSXp^.RP17HPSXp^.RP18HPSXp^.RP19HPSXp^.RP20HPSXGNPMEp
^.RP01PMEXp ^.RP02PMEXp ^.RP03PMEXp ^.RP04PMEXp ^.RP05PMEXp ^.RP06PMEXp
^.RP07PMEXp ^.RP08PMEXp ^.RP09PMEXp ^.RP10PMEXp ^.RP11PMEXp ^.RP12PMEXp
^.RP13PMEXp ^.RP14PMEXp ^.RP15PMEXp ^.RP16PMEXp ^.RP17PMEXp ^.RP18PMEXp
^.RP19PMEXp
^.RP20PMEXp^.RP01PMSXp^.RP02PMSXp^.RP03PMSXp^.RP04PMSXp^.RP05PMSXp^.RP06PMSXp^.RP07PMSXp^.RP08PMSXp^.RP09PMSXp^.RP10PMSXp^.RP11PMSXp^.RP12PMSXp^.RP13PMSXp^.RP14PMSXp^.RP15PMSXp^.RP16PMSXp^.RP17PMSXp^.RP18PMSXp^.RP19PMSXp^.RP20PMSXE\
PICM PRWP @GPRWph�RWP pySS1_ `}`ySS2_
 `}`ySS3_
 `}`ySS4_
 `�{yi ` pi�RWP �z``��RWP �RWPH2_SB_OSCI OSCO OSCP A_OSC� STS0�
CAP0��0IDpSCGE��
n�'J�<�.{H��pCAP0OSCP�{CAP0
 p
OSCO��{SGMD

��TD3 {CAP0
;CAP0}STS0
STS0�{STS0 �TS0}STS0

STS0�{STS0 �TS0}STS0
STS0�[�$EPC__HID%�_STR1
.E n c l a v e P a g e C a c h e 1 . 0 _MLS;8en 1
.E n c l a v e P a g e C a c h e 1 . 0 RBUF3
0�   y G_CRS �BUF
EMIN�BUF
EMAX�BUF
&ELENp\._PR_EMNAEMINp\._PR_ELNGELENtr\._PR_EMNA\._PR_ELNG EMAX�BUFG_DSM_T_0
BUFX/  � � � � � � � � �B�
�ƞ�?�#'^�
�� � p� _T_0��T_0 ����T_0pSEC0�UFX pSEC1�UFX pSEC2�UFX
 pSEC3�UFX
 pSEC4�UFX
 pSEC5�UFX
 pSEC6�UFX
 pSEC7�UFX
 pSEC8�UFX
 �UFX� ��_STA ��\._PR_EPCS ��8_SB_[�BTKL_HIDINT3420 _STA
�_PS0_PS3PSTS _SB_[�SLPB_HIDA�_STA
N_PR_[�CPU0 [�CPU1 [�CPU2 [�CPU3 [�CPU4 [�CPU5
[�CPU6 [�CPU7 K(._PR_CPU0CPC1F

�  q y
 
�  4 y 
� t y 
�  t y 
� t y 
� y 
� y 
� y 
� @ � y 
� @ � y 
� w y 
�  p y CPC2N


�  q y 
� � y 
� q y 
� q y 
� q y 
� t y 
�  t y 
� t y 
� y 
� y 
� y 
� @ � y 
� @ � y 
� w y 
�  p y 
� 
 t y 
� t y H_SB_[�PAGD_HIDACPI000C 0_STA �_OSIProcessor Aggregator Device
���_PUR J._SB_PCI0[�PDRC_HIDA�_UIDBUF0J
�  � �   �   �  �  �  � � @ �  P� � � �� �  �  �  y F_CRS�UF0
MBR0pGMHBMBR0�UF0
DBR0pGDMBDBR0�UF0
EBR0pGEPBEBR0�UF0
(XBR0pGPCBXBR0�UF0
,XSZ0pGPCLXSZ0�UF0
pSXRApSXRBSXRA�UF0
tSXRLpSXRSSXRL��PTE�UF0
|HBAS�UF0
�LENpHPTBHBASp HLEN�UF0*BRTN ��DIDX   �/_SB_PCI0GFX0DD1FhBn_GPEGU_L69
��\/_SB_PCI0RP01VDID�\/_SB_PCI0RP01HPME�/_SB_PCI0RP01
��\/_SB_PCI0RP02VDID�\/_SB_PCI0RP02HPME�/_SB_PCI0RP02
��\/_SB_PCI0RP03VDID�\/_SB_PCI0RP03HPME�/_SB_PCI0RP03
��\/_SB_PCI0RP04VDID�\/_SB_PCI0RP04HPME�/_SB_PCI0RP04
��\/_SB_PCI0RP05VDID�\/_SB_PCI0RP05HPME�/_SB_PCI0RP05
��\/_SB_PCI0RP06VDID�\/_SB_PCI0RP06HPME�/_SB_PCI0RP06
��\/_SB_PCI0RP07VDID�\/_SB_PCI0RP07HPME�/_SB_PCI0RP07
��\/_SB_PCI0RP08VDID�\/_SB_PCI0RP08HPME�/_SB_PCI0RP08
��\/_SB_PCI0RP09VDID�\/_SB_PCI0RP09HPME�/_SB_PCI0RP09
��\/_SB_PCI0RP10VDID�\/_SB_PCI0RP10HPME�/_SB_PCI0RP10
��\/_SB_PCI0RP11VDID�\/_SB_PCI0RP11HPME�/_SB_PCI0RP11
��\/_SB_PCI0RP12VDID�\/_SB_PCI0RP12HPME�/_SB_PCI0RP12
��\/_SB_PCI0RP13VDID�\/_SB_PCI0RP13HPME�/_SB_PCI0RP13
��\/_SB_PCI0RP14VDID�\/_SB_PCI0RP14HPME�/_SB_PCI0RP14
��\/_SB_PCI0RP15VDID�\/_SB_PCI0RP15HPME�/_SB_PCI0RP15
��\/_SB_PCI0RP16VDID�\/_SB_PCI0RP16HPME�/_SB_PCI0RP16
��\/_SB_PCI0RP17VDID�\/_SB_PCI0RP17HPME�/_SB_PCI0RP17
��\/_SB_PCI0RP18VDID�\/_SB_PCI0RP18HPME�/_SB_PCI0RP18
��\/_SB_PCI0RP19VDID�\/_SB_PCI0RP19HPME�/_SB_PCI0RP19
��\/_SB_PCI0RP20VDID�\/_SB_PCI0RP20HPME�/_SB_PCI0RP20
�/_SB_PCI0PEG0
�/_SB_PCI0PEG0PEGP
_L61 H_L62 p GPEC�[\._PR_DTSE ��\._PR_DTSE�._TZ_TZ00
�\._TZ_TZ01
�[\._GPEHLVT HLVT4_L66 ��/_SB_PCI0GFX0GSSE�SMI\/_SB_PCI0GFX0GSCI_L67 p
 \/_SB_PCI0SBUSHSTS_L68 _L50 ��CON ��PRESA_L6F
 \._SB_UGPS��TD3�[\._GPEAL6F AL6F��GGP�[\._GPEP0L6
 P0L6\._SB_CAGSP0WK��1GP�[\._GPEP1L6 P1L6\._SB_CAGSP1WK��2GP�[\._GPEP2L6
 P2L6\._SB_CAGSP2WK\._SB_CGLSH2/_SB_PCI0RP01PXSX[�PXX
[�RPXX VDID [�LDR
D
[�FLDRDCAP DCTRSPLX9  � � � � � � � � �E
SPLCpDOM1��PLX pLIM1��PLX  pTIM1��PLX
 pDOM2��PLX
 pLIM2��PLX
  pTIM2��PLX

 pDOM3��PLX
 pLIM3��PLX
  pTIM3��PLX

 �PLXWANX'  � � � � � �KWANDp ��ANX pTRD0��ANX  pTRL0��ANX
 p��ANX
 pTRD1��ANX
  pTRL1��ANX

 �ANXWRDX 
 � �
 � �NWRDDpWDM1��RDX pCID1��RDX  pWDM2��RDX
 pCID2��RDX
  �RDXCWIST_T_0 �[VDID �pVDID_T_0��T_0�Z ����T_0�[ ��
��T_0�e1��
��T_0�f1����T_0������T_0������T_0������T_0������T_0�����T_0�����T_0�����T_0������H2/_SB_PCI0RP02PXSX[�PXX
[�RPXX VDID [�LDR
D
[�FLDRDCAP DCTRSPLX9  � � � � � � � � �E
SPLCpDOM1��PLX pLIM1��PLX  pTIM1��PLX
 pDOM2��PLX
 pLIM2��PLX
  pTIM2��PLX

 pDOM3��PLX
 pLIM3��PLX
  pTIM3��PLX

 �PLXWANX'  � � � � � �KWANDp ��ANX pTRD0��ANX  pTRL0��ANX
 p��ANX
 pTRD1��ANX
  pTRL1��ANX

 �ANXWRDX 
 � �
 � �NWRDDpWDM1��RDX pCID1��RDX  pWDM2��RDX
 pCID2��RDX
  �RDXCWIST_T_0 �[VDID �pVDID_T_0��T_0�Z ����T_0�[ ��
��T_0�e1��
��T_0�f1����T_0������T_0������T_0������T_0������T_0�����T_0�����T_0�����T_0������H2/_SB_PCI0RP03PXSX[�PXX
[�RPXX VDID [�LDR
D
[�FLDRDCAP DCTRSPLX9  � � � � � � � � �E
SPLCpDOM1��PLX pLIM1��PLX  pTIM1��PLX
 pDOM2��PLX
 pLIM2��PLX
  pTIM2��PLX

 pDOM3��PLX
 pLIM3��PLX
  pTIM3��PLX

 �PLXWANX'  � � � � � �KWANDp ��ANX pTRD0��ANX  pTRL0��ANX
 p��ANX
 pTRD1��ANX
  pTRL1��ANX

 �ANXWRDX 
 � �
 � �NWRDDpWDM1��RDX pCID1��RDX  pWDM2��RDX
 pCID2��RDX
  �RDXCWIST_T_0 �[VDID �pVDID_T_0��T_0�Z ����T_0�[ ��
��T_0�e1��
��T_0�f1����T_0������T_0������T_0������T_0������T_0�����T_0�����T_0�����T_0������H2/_SB_PCI0RP04PXSX[�PXX
[�RPXX VDID [�LDR
D
[�FLDRDCAP DCTRSPLX9  � � � � � � � � �E
SPLCpDOM1��PLX pLIM1��PLX  pTIM1��PLX
 pDOM2��PLX
 pLIM2��PLX
  pTIM2��PLX

 pDOM3��PLX
 pLIM3��PLX
  pTIM3��PLX

 �PLXWANX'  � � � � � �KWANDp ��ANX pTRD0��ANX  pTRL0��ANX
 p��ANX
 pTRD1��ANX
  pTRL1��ANX

 �ANXWRDX 
 � �
 � �NWRDDpWDM1��RDX pCID1��RDX  pWDM2��RDX
 pCID2��RDX
  �RDXCWIST_T_0 �[VDID �pVDID_T_0��T_0�Z ����T_0�[ ��
��T_0�e1��
��T_0�f1����T_0������T_0������T_0������T_0������T_0�����T_0�����T_0�����T_0������H2/_SB_PCI0RP05PXSX[�PXX
[�RPXX VDID [�LDR
D
[�FLDRDCAP DCTRSPLX9  � � � � � � � � �E
SPLCpDOM1��PLX pLIM1��PLX  pTIM1��PLX
 pDOM2��PLX
 pLIM2��PLX
  pTIM2��PLX

 pDOM3��PLX
 pLIM3��PLX
  pTIM3��PLX

 �PLXWANX'  � � � � � �KWANDp ��ANX pTRD0��ANX  pTRL0��ANX
 p��ANX
 pTRD1��ANX
  pTRL1��ANX

 �ANXWRDX 
 � �
 � �NWRDDpWDM1��RDX pCID1��RDX  pWDM2��RDX
 pCID2��RDX
  �RDXCWIST_T_0 �[VDID �pVDID_T_0��T_0�Z ����T_0�[ ��
��T_0�e1��
��T_0�f1����T_0������T_0������T_0������T_0������T_0�����T_0�����T_0�����T_0������H2/_SB_PCI0RP06PXSX[�PXX
[�RPXX VDID [�LDR
D
[�FLDRDCAP DCTRSPLX9  � � � � � � � � �E
SPLCpDOM1��PLX pLIM1��PLX  pTIM1��PLX
 pDOM2��PLX
 pLIM2��PLX
  pTIM2��PLX

 pDOM3��PLX
 pLIM3��PLX
  pTIM3��PLX

 �PLXWANX'  � � � � � �KWANDp ��ANX pTRD0��ANX  pTRL0��ANX
 p��ANX
 pTRD1��ANX
  pTRL1��ANX

 �ANXWRDX 
 � �
 � �NWRDDpWDM1��RDX pCID1��RDX  pWDM2��RDX
 pCID2��RDX
  �RDXCWIST_T_0 �[VDID �pVDID_T_0��T_0�Z ����T_0�[ ��
��T_0�e1��
��T_0�f1����T_0������T_0������T_0������T_0������T_0�����T_0�����T_0�����T_0������H2/_SB_PCI0RP07PXSX[�PXX
[�RPXX VDID [�LDR
D
[�FLDRDCAP DCTRSPLX9  � � � � � � � � �E
SPLCpDOM1��PLX pLIM1��PLX  pTIM1��PLX
 pDOM2��PLX
 pLIM2��PLX
  pTIM2��PLX

 pDOM3��PLX
 pLIM3��PLX
  pTIM3��PLX

 �PLXWANX'  � � � � � �KWANDp ��ANX pTRD0��ANX  pTRL0��ANX
 p��ANX
 pTRD1��ANX
  pTRL1��ANX

 �ANXWRDX 
 � �
 � �NWRDDpWDM1��RDX pCID1��RDX  pWDM2��RDX
 pCID2��RDX
  �RDXCWIST_T_0 �[VDID �pVDID_T_0��T_0�Z ����T_0�[ ��
��T_0�e1��
��T_0�f1����T_0������T_0������T_0������T_0������T_0�����T_0�����T_0�����T_0������H2/_SB_PCI0RP08PXSX[�PXX
[�RPXX VDID [�LDR
D
[�FLDRDCAP DCTRSPLX9  � � � � � � � � �E
SPLCpDOM1��PLX pLIM1��PLX  pTIM1��PLX
 pDOM2��PLX
 pLIM2��PLX
  pTIM2��PLX

 pDOM3��PLX
 pLIM3��PLX
  pTIM3��PLX

 �PLXWANX'  � � � � � �KWANDp ��ANX pTRD0��ANX  pTRL0��ANX
 p��ANX
 pTRD1��ANX
  pTRL1��ANX

 �ANXWRDX 
 � �
 � �NWRDDpWDM1��RDX pCID1��RDX  pWDM2��RDX
 pCID2��RDX
  �RDXCWIST_T_0 �[VDID �pVDID_T_0��T_0�Z ����T_0�[ ��
��T_0�e1��
��T_0�f1����T_0������T_0������T_0������T_0������T_0�����T_0�����T_0�����T_0������H2/_SB_PCI0RP09PXSX[�PXX
[�RPXX VDID [�LDR
D
[�FLDRDCAP DCTRSPLX9  � � � � � � � � �E
SPLCpDOM1��PLX pLIM1��PLX  pTIM1��PLX
 pDOM2��PLX
 pLIM2��PLX
  pTIM2��PLX

 pDOM3��PLX
 pLIM3��PLX
  pTIM3��PLX

 �PLXWANX'  � � � � � �KWANDp ��ANX pTRD0��ANX  pTRL0��ANX
 p��ANX
 pTRD1��ANX
  pTRL1��ANX

 �ANXWRDX 
 � �
 � �NWRDDpWDM1��RDX pCID1��RDX  pWDM2��RDX
 pCID2��RDX
  �RDXCWIST_T_0 �[VDID �pVDID_T_0��T_0�Z ����T_0�[ ��
��T_0�e1��
��T_0�f1����T_0������T_0������T_0������T_0������T_0�����T_0�����T_0�����T_0������H2/_SB_PCI0RP10PXSX[�PXX
[�RPXX VDID [�LDR
D
[�FLDRDCAP DCTRSPLX9  � � � � � � � � �E
SPLCpDOM1��PLX pLIM1��PLX  pTIM1��PLX
 pDOM2��PLX
 pLIM2��PLX
  pTIM2��PLX

 pDOM3��PLX
 pLIM3��PLX
  pTIM3��PLX

 �PLXWANX'  � � � � � �KWANDp ��ANX pTRD0��ANX  pTRL0��ANX
 p��ANX
 pTRD1��ANX
  pTRL1��ANX

 �ANXWRDX 
 � �
 � �NWRDDpWDM1��RDX pCID1��RDX  pWDM2��RDX
 pCID2��RDX
  �RDXCWIST_T_0 �[VDID �pVDID_T_0��T_0�Z ����T_0�[ ��
��T_0�e1��
��T_0�f1����T_0������T_0������T_0������T_0������T_0�����T_0�����T_0�����T_0������H2/_SB_PCI0RP11PXSX[�PXX
[�RPXX VDID [�LDR
D
[�FLDRDCAP DCTRSPLX9  � � � � � � � � �E
SPLCpDOM1��PLX pLIM1��PLX  pTIM1��PLX
 pDOM2��PLX
 pLIM2��PLX
  pTIM2��PLX

 pDOM3��PLX
 pLIM3��PLX
  pTIM3��PLX

 �PLXWANX'  � � � � � �KWANDp ��ANX pTRD0��ANX  pTRL0��ANX
 p��ANX
 pTRD1��ANX
  pTRL1��ANX

 �ANXWRDX 
 � �
 � �NWRDDpWDM1��RDX pCID1��RDX  pWDM2��RDX
 pCID2��RDX
  �RDXCWIST_T_0 �[VDID �pVDID_T_0��T_0�Z ����T_0�[ ��
��T_0�e1��
��T_0�f1����T_0������T_0������T_0������T_0������T_0�����T_0�����T_0�����T_0������H2/_SB_PCI0RP12PXSX[�PXX
[�RPXX VDID [�LDR
D
[�FLDRDCAP DCTRSPLX9  � � � � � � � � �E
SPLCpDOM1��PLX pLIM1��PLX  pTIM1��PLX
 pDOM2��PLX
 pLIM2��PLX
  pTIM2��PLX

 pDOM3��PLX
 pLIM3��PLX
  pTIM3��PLX

 �PLXWANX'  � � � � � �KWANDp ��ANX pTRD0��ANX  pTRL0��ANX
 p��ANX
 pTRD1��ANX
  pTRL1��ANX

 �ANXWRDX 
 � �
 � �NWRDDpWDM1��RDX pCID1��RDX  pWDM2��RDX
 pCID2��RDX
  �RDXCWIST_T_0 �[VDID �pVDID_T_0��T_0�Z ����T_0�[ ��
��T_0�e1��
��T_0�f1����T_0������T_0������T_0������T_0������T_0�����T_0�����T_0�����T_0������H2/_SB_PCI0RP13PXSX[�PXX
[�RPXX VDID [�LDR
D
[�FLDRDCAP DCTRSPLX9  � � � � � � � � �E
SPLCpDOM1��PLX pLIM1��PLX  pTIM1��PLX
 pDOM2��PLX
 pLIM2��PLX
  pTIM2��PLX

 pDOM3��PLX
 pLIM3��PLX
  pTIM3��PLX

 �PLXWANX'  � � � � � �KWANDp ��ANX pTRD0��ANX  pTRL0��ANX
 p��ANX
 pTRD1��ANX
  pTRL1��ANX

 �ANXWRDX 
 � �
 � �NWRDDpWDM1��RDX pCID1��RDX  pWDM2��RDX
 pCID2��RDX
  �RDXCWIST_T_0 �[VDID �pVDID_T_0��T_0�Z ����T_0�[ ��
��T_0�e1��
��T_0�f1����T_0������T_0������T_0������T_0������T_0�����T_0�����T_0�����T_0������H2/_SB_PCI0RP14PXSX[�PXX
[�RPXX VDID [�LDR
D
[�FLDRDCAP DCTRSPLX9  � � � � � � � � �E
SPLCpDOM1��PLX pLIM1��PLX  pTIM1��PLX
 pDOM2��PLX
 pLIM2��PLX
  pTIM2��PLX

 pDOM3��PLX
 pLIM3��PLX
  pTIM3��PLX

 �PLXWANX'  � � � � � �KWANDp ��ANX pTRD0��ANX  pTRL0��ANX
 p��ANX
 pTRD1��ANX
  pTRL1��ANX

 �ANXWRDX 
 � �
 � �NWRDDpWDM1��RDX pCID1��RDX  pWDM2��RDX
 pCID2��RDX
  �RDXCWIST_T_0 �[VDID �pVDID_T_0��T_0�Z ����T_0�[ ��
��T_0�e1��
��T_0�f1����T_0������T_0������T_0������T_0������T_0�����T_0�����T_0�����T_0������H2/_SB_PCI0RP15PXSX[�PXX
[�RPXX VDID [�LDR
D
[�FLDRDCAP DCTRSPLX9  � � � � � � � � �E
SPLCpDOM1��PLX pLIM1��PLX  pTIM1��PLX
 pDOM2��PLX
 pLIM2��PLX
  pTIM2��PLX

 pDOM3��PLX
 pLIM3��PLX
  pTIM3��PLX

 �PLXWANX'  � � � � � �KWANDp ��ANX pTRD0��ANX  pTRL0��ANX
 p��ANX
 pTRD1��ANX
  pTRL1��ANX

 �ANXWRDX 
 � �
 � �NWRDDpWDM1��RDX pCID1��RDX  pWDM2��RDX
 pCID2��RDX
  �RDXCWIST_T_0 �[VDID �pVDID_T_0��T_0�Z ����T_0�[ ��
��T_0�e1��
��T_0�f1����T_0������T_0������T_0������T_0������T_0�����T_0�����T_0�����T_0������H2/_SB_PCI0RP16PXSX[�PXX
[�RPXX VDID [�LDR
D
[�FLDRDCAP DCTRSPLX9  � � � � � � � � �E
SPLCpDOM1��PLX pLIM1��PLX  pTIM1��PLX
 pDOM2��PLX
 pLIM2��PLX
  pTIM2��PLX

 pDOM3��PLX
 pLIM3��PLX
  pTIM3��PLX

 �PLXWANX'  � � � � � �KWANDp ��ANX pTRD0��ANX  pTRL0��ANX
 p��ANX
 pTRD1��ANX
  pTRL1��ANX

 �ANXWRDX 
 � �
 � �NWRDDpWDM1��RDX pCID1��RDX  pWDM2��RDX
 pCID2��RDX
  �RDXCWIST_T_0 �[VDID �pVDID_T_0��T_0�Z ����T_0�[ ��
��T_0�e1��
��T_0�f1����T_0������T_0������T_0������T_0������T_0�����T_0�����T_0�����T_0������H2/_SB_PCI0RP17PXSX[�PXX
[�RPXX VDID [�LDR
D
[�FLDRDCAP DCTRSPLX9  � � � � � � � � �E
SPLCpDOM1��PLX pLIM1��PLX  pTIM1��PLX
 pDOM2��PLX
 pLIM2��PLX
  pTIM2��PLX

 pDOM3��PLX
 pLIM3��PLX
  pTIM3��PLX

 �PLXWANX'  � � � � � �KWANDp ��ANX pTRD0��ANX  pTRL0��ANX
 p��ANX
 pTRD1��ANX
  pTRL1��ANX

 �ANXWRDX 
 � �
 � �NWRDDpWDM1��RDX pCID1��RDX  pWDM2��RDX
 pCID2��RDX
  �RDXCWIST_T_0 �[VDID �pVDID_T_0��T_0�Z ����T_0�[ ��
��T_0�e1��
��T_0�f1����T_0������T_0������T_0������T_0������T_0�����T_0�����T_0�����T_0������H2/_SB_PCI0RP18PXSX[�PXX
[�RPXX VDID [�LDR
D
[�FLDRDCAP DCTRSPLX9  � � � � � � � � �E
SPLCpDOM1��PLX pLIM1��PLX  pTIM1��PLX
 pDOM2��PLX
 pLIM2��PLX
  pTIM2��PLX

 pDOM3��PLX
 pLIM3��PLX
  pTIM3��PLX

 �PLXWANX'  � � � � � �KWANDp ��ANX pTRD0��ANX  pTRL0��ANX
 p��ANX
 pTRD1��ANX
  pTRL1��ANX

 �ANXWRDX 
 � �
 � �NWRDDpWDM1��RDX pCID1��RDX  pWDM2��RDX
 pCID2��RDX
  �RDXCWIST_T_0 �[VDID �pVDID_T_0��T_0�Z ����T_0�[ ��
��T_0�e1��
��T_0�f1����T_0������T_0������T_0������T_0������T_0�����T_0�����T_0�����T_0������H2/_SB_PCI0RP19PXSX[�PXX
[�RPXX VDID [�LDR
D
[�FLDRDCAP DCTRSPLX9  � � � � � � � � �E
SPLCpDOM1��PLX pLIM1��PLX  pTIM1��PLX
 pDOM2��PLX
 pLIM2��PLX
  pTIM2��PLX

 pDOM3��PLX
 pLIM3��PLX
  pTIM3��PLX

 �PLXWANX'  � � � � � �KWANDp ��ANX pTRD0��ANX  pTRL0��ANX
 p��ANX
 pTRD1��ANX
  pTRL1��ANX

 �ANXWRDX 
 � �
 � �NWRDDpWDM1��RDX pCID1��RDX  pWDM2��RDX
 pCID2��RDX
  �RDXCWIST_T_0 �[VDID �pVDID_T_0��T_0�Z ����T_0�[ ��
��T_0�e1��
��T_0�f1����T_0������T_0������T_0������T_0������T_0�����T_0�����T_0�����T_0������H2/_SB_PCI0RP20PXSX[�PXX
[�RPXX VDID [�LDR
D
[�FLDRDCAP DCTRSPLX9  � � � � � � � � �E
SPLCpDOM1��PLX pLIM1��PLX  pTIM1��PLX
 pDOM2��PLX
 pLIM2��PLX
  pTIM2��PLX

 pDOM3��PLX
 pLIM3��PLX
  pTIM3��PLX

 �PLXWANX'  � � � � � �KWANDp ��ANX pTRD0��ANX  pTRL0��ANX
 p��ANX
 pTRD1��ANX
  pTRL1��ANX

 �ANXWRDX 
 � �
 � �NWRDDpWDM1��RDX pCID1��RDX  pWDM2��RDX
 pCID2��RDX
  �RDXCWIST_T_0 �[VDID �pVDID_T_0��T_0�Z ����T_0�[ ��
��T_0�e1��
��T_0�f1����T_0������T_0������T_0������T_0������T_0�����T_0�����T_0�����T_0������A._SB_PCI0(WHIT
� DockOemId DockSkuId

SELF �PcOemId PcSkuId ,/_SB_PCI0GFX0_DEP ��0ID�PEPD��
8/_SB_PCI0SAT0(_DEP ��S0ID�{PEPC
 �PEPD��
��0ID/_SB_PCI0I2C0_DEPPEPD/_SB_PCI0I2C1_DEPPEPD/_SB_PCI0I2C2_DEPPEPD/_SB_PCI0I2C3_DEPPEPD/_SB_PCI0I2C4_DEPPEPD/_SB_PCI0I2C5_DEPPEPD/_SB_PCI0SPI0_DEPPEPD/_SB_PCI0SPI1_DEPPEPD/_SB_PCI0UA00_DEPPEPD/_SB_PCI0UA01_DEPPEPD/_SB_PCI0UA02_DEPPEPD,/_SB_PCI0XHC__DEP
��0ID�PEPD�� F/_SB_PCI0RP01PXSXF_DEP ��AHCPNVM���0ID�OSYS��{PEPC
�PEPC

�PEPD� [�CCX

[�PCCXPIXXSCCXBCCX#PAHC��CCX��CCX
��IXX��$PNVM��CCX��CCX
��IXX
��F/_SB_PCI0RP02PXSXF_DEP ��AHCPNVM���0ID�OSYS��{PEPC �PEPC

�PEPD� [�CCX

[�PCCXPIXXSCCXBCCX#PAHC��CCX��CCX
��IXX��$PNVM��CCX��CCX
��IXX
��F/_SB_PCI0RP03PXSXF_DEP ��AHCPNVM���0ID�OSYS��{PEPC �PEPC

�PEPD� [�CCX

[�PCCXPIXXSCCXBCCX#PAHC��CCX��CCX
��IXX��$PNVM��CCX��CCX
��IXX
��F/_SB_PCI0RP04PXSXF_DEP ��AHCPNVM���0ID�OSYS��{PEPC �PEPC

�PEPD� [�CCX

[�PCCXPIXXSCCXBCCX#PAHC��CCX��CCX
��IXX��$PNVM��CCX��CCX
��IXX
��F/_SB_PCI0RP05PXSXF_DEP ��AHCPNVM���0ID�OSYS��{PEPC �PEPC

�PEPD� [�CCX

[�PCCXPIXXSCCXBCCX#PAHC��CCX��CCX
��IXX��$PNVM��CCX��CCX
��IXX
��F/_SB_PCI0RP06PXSXF_DEP ��AHCPNVM���0ID�OSYS��{PEPC �PEPC

�PEPD� [�CCX

[�PCCXPIXXSCCXBCCX#PAHC��CCX��CCX
��IXX��$PNVM��CCX��CCX
��IXX
��F/_SB_PCI0RP07PXSXF_DEP ��AHCPNVM���0ID�OSYS��{PEPC �PEPC

�PEPD� [�CCX

[�PCCXPIXXSCCXBCCX#PAHC��CCX��CCX
��IXX��$PNVM��CCX��CCX
��IXX
��F/_SB_PCI0RP08PXSXF_DEP ��AHCPNVM���0ID�OSYS��{PEPC �PEPC

�PEPD� [�CCX

[�PCCXPIXXSCCXBCCX#PAHC��CCX��CCX
��IXX��$PNVM��CCX��CCX
��IXX
��F/_SB_PCI0RP09PXSXF_DEP ��AHCPNVM���0ID�OSYS��{PEPC �PEPC

�PEPD� [�CCX

[�PCCXPIXXSCCXBCCX#PAHC��CCX��CCX
��IXX��$PNVM��CCX��CCX
��IXX
��F/_SB_PCI0RP10PXSXF_DEP ��AHCPNVM���0ID�OSYS��{PEPC �PEPC

�PEPD� [�CCX

[�PCCXPIXXSCCXBCCX#PAHC��CCX��CCX
��IXX��$PNVM��CCX��CCX
��IXX
��F/_SB_PCI0RP11PXSXF_DEP ��AHCPNVM���0ID�OSYS��{PEPC �PEPC

�PEPD� [�CCX

[�PCCXPIXXSCCXBCCX#PAHC��CCX��CCX
��IXX��$PNVM��CCX��CCX
��IXX
��F/_SB_PCI0RP12PXSXF_DEP ��AHCPNVM���0ID�OSYS��{PEPC �PEPC

�PEPD� [�CCX

[�PCCXPIXXSCCXBCCX#PAHC��CCX��CCX
��IXX��$PNVM��CCX��CCX
��IXX
��F/_SB_PCI0RP13PXSXF_DEP ��AHCPNVM���0ID�OSYS��{PEPC �PEPC

�PEPD� [�CCX

[�PCCXPIXXSCCXBCCX#PAHC��CCX��CCX
��IXX��$PNVM��CCX��CCX
��IXX
��F/_SB_PCI0RP14PXSXF_DEP ��AHCPNVM���0ID�OSYS��{PEPC �PEPC

�PEPD� [�CCX

[�PCCXPIXXSCCXBCCX#PAHC��CCX��CCX
��IXX��$PNVM��CCX��CCX
��IXX
��F/_SB_PCI0RP15PXSXF_DEP ��AHCPNVM���0ID�OSYS��{PEPC �PEPC

�PEPD� [�CCX

[�PCCXPIXXSCCXBCCX#PAHC��CCX��CCX
��IXX��$PNVM��CCX��CCX
��IXX
��F/_SB_PCI0RP16PXSXF_DEP ��AHCPNVM���0ID�OSYS��{PEPC �PEPC

�PEPD� [�CCX

[�PCCXPIXXSCCXBCCX#PAHC��CCX��CCX
��IXX��$PNVM��CCX��CCX
��IXX
��F/_SB_PCI0RP17PXSXF_DEP ��AHCPNVM���0ID�OSYS��{PEPC �PEPC

�PEPD� [�CCX

[�PCCXPIXXSCCXBCCX#PAHC��CCX��CCX
��IXX��$PNVM��CCX��CCX
��IXX
��F/_SB_PCI0RP18PXSXF_DEP ��AHCPNVM���0ID�OSYS��{PEPC �PEPC

�PEPD� [�CCX

[�PCCXPIXXSCCXBCCX#PAHC��CCX��CCX
��IXX��$PNVM��CCX��CCX
��IXX
��F/_SB_PCI0RP19PXSXF_DEP ��AHCPNVM���0ID�OSYS��{PEPC �PEPC

�PEPD� [�CCX

[�PCCXPIXXSCCXBCCX#PAHC��CCX��CCX
��IXX��$PNVM��CCX��CCX
��IXX
��F/_SB_PCI0RP20PXSXF_DEP ��AHCPNVM���0ID�OSYS��{PEPC �PEPC

�PEPD� [�CCX

[�PCCXPIXXSCCXBCCX#PAHC��CCX��CCX
��IXX��$PNVM��CCX��CCX
��IXX
��C._PR_CPU0GXDEP ADBGCPU0 DEP Call ��0IDADBGCPU0 DEP �\._SB_PEPD�ADBGCPU0
DEP NULL � C._PR_CPU1GXDEP ADBGCPU1 DEP Call ��0IDADBGCPU1 DEP
�\._SB_PEPD�ADBGCPU1 DEP NULL � C._PR_CPU2GXDEP ADBGCPU2 DEP Call
��0IDADBGCPU2 DEP �\._SB_PEPD�ADBGCPU2 DEP NULL � C._PR_CPU3GXDEP ADBGCPU3
DEP Call ��0IDADBGCPU3 DEP �\._SB_PEPD�ADBGCPU3 DEP NULL � C._PR_CPU4GXDEP
ADBGCPU4 DEP Call ��0IDADBGCPU4 DEP �\._SB_PEPD�ADBGCPU4 DEP NULL �
C._PR_CPU5GXDEP ADBGCPU5 DEP Call ��0IDADBGCPU5 DEP �\._SB_PEPD�ADBGCPU5
DEP NULL � C._PR_CPU6GXDEP ADBGCPU6 DEP Call ��0IDADBGCPU6 DEP
�\._SB_PEPD�ADBGCPU6 DEP NULL � C._PR_CPU7GXDEP ADBGCPU7 DEP Call
��0IDADBGCPU7 DEP �\._SB_PEPD�ADBGCPU7 DEP NULL � �_SB_[��PEPD_HIDINT33A1
_CIDA��_UIDDEVYLV)\_PR.CPU0   
�\_PR.CPU1   
�\_PR.CPU2   
�\_PR.CPU3   
�\_SB.PCI0.GFX0 
 
�\_SB.PCI0.SAT0  
�\_SB.PCI0.UA00 
 
�\_SB.PCI0.UA01 
 
�\_SB.PCI0.I2C0 
 
�\_SB.PCI0.I2C1 
 
�\_SB.PCI0.XHC 
 
�0INTELAUDIO\FUNC_01&VEN_10EC*   
\_SB.PCI0.PEMC 
 
�\_SB.PCI0.PSDC 
 
�\_SB.PCI0.I2C2 
 
�\_SB.PCI0.I2C3 
 
�\_SB.PCI0.I2C4 
 
�\_SB.PCI0.I2C5 
 
�\_SB.PCI0.UA02 
 
�\_SB.PCI0.SPI0 
 
�\_SB.PCI0.SPI1 
 
�$\_SB.PCI0.RP01.PXSX  
�$\_SB.PCI0.RP02.PXSX  
�$\_SB.PCI0.RP03.PXSX  
�$\_SB.PCI0.RP04.PXSX  
�$\_SB.PCI0.RP05.PXSX  
�$\_SB.PCI0.RP06.PXSX  
�$\_SB.PCI0.RP07.PXSX  
�$\_SB.PCI0.RP08.PXSX  
�$\_SB.PCI0.RP09.PXSX  
�$\_SB.PCI0.RP10.PXSX  
�$\_SB.PCI0.RP11.PXSX  
�$\_SB.PCI0.RP12.PXSX  
�$\_SB.PCI0.RP13.PXSX  
�$\_SB.PCI0.RP14.PXSX  
�$\_SB.PCI0.RP15.PXSX  
�$\_SB.PCI0.RP16.PXSX  
�$\_SB.PCI0.RP17.PXSX  
�$\_SB.PCI0.RP18.PXSX  
�$\_SB.PCI0.RP19.PXSX  
�$\_SB.PCI0.RP20.PXSX  
�BCCDHP,\_SB.PCI0.SAT0  
 
�
��1\_SB.PCI0.SAT0.PRT0  
 
�
��1\_SB.PCI0.SAT0.PRT1  
 
�
��1\_SB.PCI0.SAT0.PRT2  
 
�
��1\_SB.PCI0.SAT0.PRT3  
 
�
��3\_SB.PCI0.RP01.PXSX  
 
�
�� 3\_SB.PCI0.RP02.PXSX  
 
�
�� 3\_SB.PCI0.RP03.PXSX  
 
�
�� 3\_SB.PCI0.RP04.PXSX  
 
�
�� 3\_SB.PCI0.RP05.PXSX  
 
�
�� 3\_SB.PCI0.RP06.PXSX  
 
�
�� 3\_SB.PCI0.RP07.PXSX  
 
�
�� 3\_SB.PCI0.RP08.PXSX  
 
�
�� 3\_SB.PCI0.RP09.PXSX  
 
�
�� 3\_SB.PCI0.RP10.PXSX  
 
�
�� 3\_SB.PCI0.RP11.PXSX  
 
�
�� 3\_SB.PCI0.RP12.PXSX  
 
�
�� 3\_SB.PCI0.RP13.PXSX  
 
�
�� 3\_SB.PCI0.RP14.PXSX  
 
�
�� 3\_SB.PCI0.RP15.PXSX  
 
�
�� 3\_SB.PCI0.RP16.PXSX  
 
�
�� 3\_SB.PCI0.RP17.PXSX  
 
�
�� 3\_SB.PCI0.RP18.PXSX  
 
�
�� 3\_SB.PCI0.RP19.PXSX  
 
�
�� 3\_SB.PCI0.RP20.PXSX  
 
�
�� _STA ���SYS��0ID��L�DSMADBGsPEPC = �EPC �֓h
��l����� ��Гj��0ID � �I�PEPC
 �{SPST
 p��EVY
  ��^/PCI0RP01PXSXPAHC^^/PCI0RP01PXSXPNVMp��EVY
  ��^/PCI0RP02PXSXPAHC^^/PCI0RP02PXSXPNVMp��EVY
  ��^/PCI0RP03PXSXPAHC^^/PCI0RP03PXSXPNVMp��EVY
  ��^/PCI0RP04PXSXPAHC^^/PCI0RP04PXSXPNVMp��EVY
  ��^/PCI0RP05PXSXPAHC^^/PCI0RP05PXSXPNVMp��EVY
  ��^/PCI0RP06PXSXPAHC^^/PCI0RP06PXSXPNVMp��EVY
  ��^/PCI0RP07PXSXPAHC^^/PCI0RP07PXSXPNVMp��EVY
  ��^/PCI0RP08PXSXPAHC^^/PCI0RP08PXSXPNVMp��EVY
  ��^/PCI0RP09PXSXPAHC^^/PCI0RP09PXSXPNVMp��EVY
  ��^/PCI0RP10PXSXPAHC^^/PCI0RP10PXSXPNVMp��EVY
  ��^/PCI0RP11PXSXPAHC^^/PCI0RP11PXSXPNVMp��EVY
  ��^/PCI0RP12PXSXPAHC^^/PCI0RP12PXSXPNVMp��EVY
   ��^/PCI0RP13PXSXPAHC^^/PCI0RP13PXSXPNVMp��EVY
!  ��^/PCI0RP14PXSXPAHC^^/PCI0RP14PXSXPNVMp��EVY
"  ��^/PCI0RP15PXSXPAHC^^/PCI0RP15PXSXPNVMp��EVY
#  ��^/PCI0RP16PXSXPAHC^^/PCI0RP16PXSXPNVMp��EVY
$  ��^/PCI0RP17PXSXPAHC^^/PCI0RP17PXSXPNVMp��EVY
%  ��^/PCI0RP18PXSXPAHC^^/PCI0RP18PXSXPNVMp��EVY
&  ��^/PCI0RP19PXSXPAHC^^/PCI0RP19PXSXPNVMp��EVY
'  ��^/PCI0RP20PXSXPAHC^^/PCI0RP20PXSXPNVMp��EVY
(  ��PEPC
 p ��EVY
  ��PEPC
 p ��EVY
  ��PEPC
 ��PEPC
  p ��EVY
  ��PEPC
@ p ��EVY
	  ��PEPC
� p ��EVY

  ��PEPC  p ��EVY
  ��PEPC  p ��EVY
  ��PEPC  p ��EVY  p ��EVY  p ��EVY
  p ��EVY
  ��PEPC  p ��EVY
  ��PEPC  p ��EVY
  ��PEPC p ��EVY
  ��PEPC @ p ��EVY
  ��PEPC � p ��EVY
  ��PEPC  p ��EVY
  ��PEPC  p ��EVY
  ��PEPC  p ��EVY
  ��PEPC  p ��EVY
  �e�OSYS��^^/PCI0RP02PXSXWISTp
����EVY

   p ����EVY

 
 p��EVY
  �^^/PCI0RP03PXSXWISTp
����EVY

   p ����EVY

 
 p��EVY
  �^^/PCI0RP04PXSXWISTp
����EVY

   p ����EVY

 
 p��EVY
  �^^/PCI0RP05PXSXWISTp
����EVY

   p ����EVY

 
 p��EVY
  �^^/PCI0RP06PXSXWISTp
����EVY

   p ����EVY

 
 p��EVY
  �^^/PCI0RP07PXSXWISTp
����EVY

   p ����EVY

 
 p��EVY
  �^^/PCI0RP08PXSXWISTp
����EVY

   p ����EVY

 
 p��EVY
  �^^/PCI0RP09PXSXWISTp
����EVY

   p ����EVY

 
 p��EVY
  �^^/PCI0RP10PXSXWISTp
����EVY

   p ����EVY

 
 p��EVY
  �^^/PCI0RP11PXSXWISTp
����EVY

   p ����EVY

 
 p��EVY
  �^^/PCI0RP12PXSXWISTp
����EVY

   p ����EVY

 
 p��EVY
   �^^/PCI0RP13PXSXWISTp
����EVY
!
   p ����EVY
!
 
 p��EVY
!  �^^/PCI0RP14PXSXWISTp
����EVY
"
   p ����EVY
"
 
 p��EVY
"  �^^/PCI0RP15PXSXWISTp
����EVY
#
   p ����EVY
#
 
 p��EVY
#  �^^/PCI0RP16PXSXWISTp
����EVY
$
   p ����EVY
$
 
 p��EVY
$  �^^/PCI0RP17PXSXWISTp
����EVY
%
   p ����EVY
%
 
 p��EVY
%  �^^/PCI0RP18PXSXWISTp
����EVY
&
   p ����EVY
&
 
 p��EVY
&  �^^/PCI0RP19PXSXWISTp
����EVY
'
   p ����EVY
'
 
 p��EVY
'  �^^/PCI0RP20PXSXWISTp
����EVY
(
   p ����EVY
(
 
 p��EVY
(  �EVY��
�CCD��
��
��
��0IDGUAM��
��0IDGUAM �BUFN MBUF [�DBG � [�MDBGMDG0�$DB2H �MDENSHOWhMDGC
 pMBUFMDG0��'DW2H ph`zh
a{`
�
�2HavBUFNDB2H`)DD2H ph`zh
a{`�a�W2HavBUFNDW2H`GMBGS �MDENp�`BUFS`phBUFSMDGC
 �`MDGC�BUFSt�` v`pMBUFMDG0��GADBG �MDENp�`BUFS`phBUFSMDGC
 �`MDGC�BUFSt�` v`pMBUFMDG0��SHOW MDGCNTOCzh
 MDGCNTOCh LINEpBUFN`{`
`�`MDGC u`{`
`8MDGC ph�BUFBUFN rBUFNBUFN��UFN�UFN�FNUP_L
)UP_L phbyb
bMOVEbt bc�bp �BUFc ucvb4MOVE phdp BUFNt de�evep�MBUFd �BUFBUFN
uBUFNudNTOC {h
`��

r`
0`�r`
7`�[�+PSM__HID%� _UID _STR/
,P o w e r S h a r i n g M a n a g e r _STA ��SME���SPLX'  � � � � �
�ASPLCpPDT1��PLX pPLM1��PLX  pPTW1��PLX
 pPDT2��PLX
 pPLM2��PLX
  pPTW2��PLX

 �PLXDPLX@ - � �  � � � � � �- � �  � � � � � �HDPLCpDDT1��PLX
pDDP1��PLX  pDLI1���PLX
 pDPL1���PLX
  pDTW1���PLX

 pDMI1���PLX

 pDMA1���PLX

 pDMT1���PLX

 pDDT2��PLX
 pDDP2��PLX
  pDLI2���PLX

 pDPL2���PLX

  pDTW2���PLX


 pDMI2���PLX


 pDMA2���PLX


 pDMT2���PLX


 �PLX��AMT D_SB_[�ICAM_HIDINT33A3 IDFU IPWR _STA��VDF��G_DSM_T_0
��
�`]BH��s�p� _T_0��T_0 ��i �� ���T_0��� SGOV  p IDFU�SGOV
pIDFU����T_0
��� SGOV
  pIPWR�SGOV
 p IPWR����� �._SB_PCI0CIICB
_T_0 �pi_T_0��T_0 IIC0&
#�    � \_SB.PCI0.I2C0 y �IC0
DAD0phDAD0�IC0���T_0IIC1&
#�    � \_SB.PCI0.I2C1 y �IC1
DAD1phDAD1�IC1���T_0
IIC2&
#�    � \_SB.PCI0.I2C2 y �IC2
DAD2phDAD2�IC2���T_0
IIC3&
#�    � \_SB.PCI0.I2C3 y �IC3
DAD3phDAD3�IC3� ��T_0
IIC4&
#�    � \_SB.PCI0.I2C4 y �IC4
DAD4phDAD4�IC4�IIC5&
#�    � \_SB.PCI0.I2C5 y �IC5
DAD5phDAD5�IC5�GPINR
GPIR-
*�     ( �SB.PCI0.GPI0 y �PIR
PINFprw
i h PINF�PIR#DSMIyk
cyj
byi
a}ah`}`b`}`c`�#GPPIyk
cyj
byi
a}ah`}`b`}`c`�J!GRID _T_0 BUF_
	�ph_T_0��T_0 pL0H0�UF_ pL0H1�UF_ pL0H2�UF_
 pL0H3�UF_
 pL0H4�UF_
 pL0H5�UF_
 pL0H6�UF_
 pL0H7�UF_
 pL0H8�UF_
 ���T_0pL1H0�UF_ pL1H1�UF_ pL1H2�UF_
 pL1H3�UF_
 pL1H4�UF_
 pL1H5�UF_
 pL1H6�UF_
 pL1H7�UF_
 pL1H8�UF_
 ���T_0
pL2H0�UF_ pL2H1�UF_ pL2H2�UF_
 pL2H3�UF_
 pL2H4�UF_
 pL2H5�UF_
 pL2H6�UF_
 pL2H7�UF_
 pL2H8�UF_
 �pL3H0�UF_ pL3H1�UF_ pL3H2�UF_
 pL3H3�UF_
 pL3H4�UF_
 pL3H5�UF_
 pL3H6�UF_
 pL3H7�UF_
 pL3H8�UF_
 ��UF_�HCID _T_1 _T_0 �ph_T_0��T_0 pL0SM`���T_0pL1SM`���T_0
pL2SM`�pL3SM`�Mp`_T_1��T_1 �INT3471 ���T_1�INT33BE ���T_1
�INT3476 ���T_1
�INT3477 � ��T_1
�INT3474 ���T_1
�INT3473 ���T_1
�INT3475 ���T_1
�INT3478 ���T_1
�INT3479 ���T_1
	�INT347A ���T_1

�INT347B ��RIDh�I2CDEP _T_3 _T_2 _T_1 _T_0 �� �
�0TP�
pL0BS_T_0��T_0 �
DSC0I2C0���T_0�
DSC0I2C1���T_0
�
DSC0I2C2���T_0
�
DSC0I2C3���T_0
�
DSC0I2C4���T_0
�
DSC0I2C5��DSC0��0TP�CLP0���
�1TP�
pL1BS_T_1��T_1 �
DSC1I2C0���T_1�
DSC1I2C1���T_1
�
DSC1I2C2���T_1
�
DSC1I2C3���T_1
�
DSC1I2C4���T_1
�
DSC1I2C5��DSC1��1TP�CLP1��
�
�2TP�
pL2BS_T_2��T_2 �
DSC2I2C0���T_2�
DSC2I2C1���T_2
�
DSC2I2C2���T_2
�
DSC2I2C3���T_2
�
DSC2I2C4���T_2
�
DSC2I2C5��DSC2��2TP�CLP2��
�
�3TP�
pL3BS_T_3��T_3 �
DSC3I2C0���T_3�
DSC3I2C1���T_3
�
DSC3I2C2���T_3
�
DSC3I2C3���T_3
�
DSC3I2C4���T_3
�
DSC3I2C5��DSC3��3TP�CLP3�PCI0[�DSC0_ADR _HIDINT3472 _CIDINT3472
_DDNPMIC-CRDG _UID K_CRS p
y `��0GP pPINRC0P0C0G0a�a`��0GPpPINRC0P1C0G1a�a`��0GP
pPINRC0P2C0G2a�a`��0GP
pPINRC0P3C0G3a�a`�_STA �CL00��0TP��NCLDB PAR_#
  pC0TP�AR_ pC0CV�AR_
 �AR_I_DSM��
@F#y�O���uo�� �� �?�����0GP��
�PPIC0F0rw
C0G0 C0P0 C0I0C0A0��
�PPIC0F1rw
C0G1 C0P1 C0I1C0A1��
�PPIC0F2rw
C0G2 C0P2 C0I2C0A2��
�PPIC0F3rw
C0G3 C0P3 C0I3C0A3� [�DSC1_ADR _HIDINT3472 _CIDINT3472 _DDNPMIC-CRDG
_UIDK_CRS p
y `��1GP pPINRC1P0C1G0a�a`��1GPpPINRC1P1C1G1a�a`��1GP
pPINRC1P2C1G2a�a`��1GP
pPINRC1P3C1G3a�a`�_STA �CL01��1TP��NCLDB PAR_#
   pC1TP�AR_ pC1CV�AR_
 �AR_D_DSM��
@F#y�O���uo�� �� �?�����1GP��
�PPIC1F0rw
C1G0 C1P0 C1I0C1A0��
�PPIC1F1rw
C1G1 C1P1 C1I1C1A1��
�PPIC1F2rw
C1G2 C1P2 C1I2C1A2��
�PPIC1F3rw
C1G3 C1P3 C1I3C1A3[�DSC2_ADR _HIDINT3472 _CIDINT3472 _DDNPMIC-CRDG _UID
K_CRS p
y `��2GP pPINRC2P0C2G0a�a`��2GPpPINRC2P1C2G1a�a`��2GP
pPINRC2P2C2G2a�a`��2GP
pPINRC2P3C2G3a�a`�_STA �CL02��2TP��NCLDB PAR_#
   pC2TP�AR_ pC2CV�AR_
 �AR_D_DSM��
@F#y�O���uo�� �� �?�����2GP��
�PPIC2F0rw
C2G0 C2P0 C2I0C2A0��
�PPIC2F1rw
C2G1 C2P1 C2I1C2A1��
�PPIC2F2rw
C2G2 C2P2 C2I2C2A2��
�PPIC2F3rw
C2G3 C2P3 C2I3C2A3[�DSC3_ADR _HIDINT3472 _CIDINT3472 _DDNPMIC-CRDG _UID
K_CRS p
y `��3GP pPINRC3P0C3G0a�a`��3GPpPINRC3P1C3G1a�a`��3GP
pPINRC3P2C3G2a�a`��3GP
pPINRC3P3C3G3a�a`�_STA �CL03��3TP��NCLDB PAR_#
   pC3TP�AR_ pC3CV�AR_
 �AR_D_DSM��
@F#y�O���uo�� �� �?�����3GP��
�PPIC3F0rw
C3G0 C3P0 C3I0C3A0��
�PPIC3F1rw
C3G1 C3P1 C3I1C3A1��
�PPIC3F2rw
C3G2 C3P2 C3I2C3A2��
�PPIC3F3rw
C3G3 C3P3 C3I3C3A3[� CLP0_ADR 6_DEP �CL00��0IB
�I2C2��0IB
�I2C3�PCI0_UID _HIDINT3472 _CIDINT3472 _DDNPMIC-CRDG _CRS p
y `�IICBC0IAC0IB`�_STA �CL00��0TP��NCLDB PAR_#
  pC0TP�AR_ pC0CV�AR_
 �AR_D_PLDPLDB
� )  ���LDB
BPOSpC0PLBPOS�LDBJ_DSM��
Iu%&q�L�ĉ�H�� �� ��������
�SMI
C0IA C0IB��
�X}�G�v1vAK�� �� �����DSMB
4�SMB I2CC�SMB
DEV0pI2CCpDSMI
C0IA C0IBDEV0�SMB� [� CLP1_ADR 6_DEP �CL01��1IB
�I2C2��1IB
�I2C3�PCI0_HIDINT3472 _CIDINT3472 _DDNPMIC-CRDG _UID_CRS p
y `�IICBC1IAC1IB`�_STA �CL01��1TP��NCLDB PAR_#
   pC1TP�AR_ pC1CV�AR_
 �AR_D_PLDPLDB
� )  ���LDB
BPOSpC1PLBPOS�LDBJ_DSM��
Iu%&q�L�ĉ�H�� �� ��������
�SMI
C1IA C1IB��
�X}�G�v1vAK�� �� �����DSMB
4�SMB I2CC�SMB
DEV0pI2CCpDSMI
C1IA C1IBDEV0�SMB� [� CLP2_ADR 6_DEP �CL02��2IB
�I2C2��2IB
�I2C3�PCI0_HIDINT3472 _CIDINT3472 _DDNPMIC-CRDG _UID
_CRS p
y `�IICBC2IAC2IB`�_STA �CL02��2TP��NCLDB PAR_#
   pC2TP�AR_ pC2CV�AR_
 �AR_D_PLDPLDB
� )  ���LDB
BPOSpC2PLBPOS�LDBJ_DSM��
Iu%&q�L�ĉ�H�� �� ��������
�SMI
C2IA C2IB��
�X}�G�v1vAK�� �� �����DSMB
4�SMB I2CC�SMB
DEV0pI2CCpDSMI
C2IA C2IBDEV0�SMB� [� CLP3_ADR 6_DEP �CL03��3IB
�I2C2��3IB
�I2C3�PCI0_HIDINT3472 _CIDINT3472 _DDNPMIC-CRDG _UID
_CRS p
y `�IICBC3IAC3IB`�_STA �CL03��3TP��NCLDB PAR_#
   pC3TP�AR_ pC3CV�AR_
 �AR_D_PLDPLDB
� )  ���LDB
BPOSpC3PLBPOS�LDBJ_DSM��
Iu%&q�L�ĉ�H�� �� ��������
�SMI
C3IA C3IB��
�X}�G�v1vAK�� �� �����DSMB
4�SMB I2CC�SMB
DEV0pI2CCpDSMI
C3IA C3IBDEV0�SMB� [��NK0_ADR _STA �L0EN���_DEP
�L0EN�DEPL0CL��PCI0_UID _HID �CID _CID �CID F_DDN BUF_
pL0M0�UF_ pL0M1�UF_ pL0M2�UF_
 pL0M3�UF_
 pL0M4�UF_
 pL0M5�UF_
 pL0M6�UF_
 pL0M7�UF_
 pL0M8�UF_
 pL0M9�UF_
	 pL0MA�UF_

 pL0MB�UF_
 pL0MC�UF_
 pL0MD�UF_
 pL0ME�UF_
 pL0MF�UF_
 �BUF_�_PLDPLDB
� i  ���LDB
BPOSpL0PLBPOS�LDBC_CRS p
y `��0DI pIICBL0A0L0BSa�a`��0DIpIICBL0A1L0BSa�a`��0DI
pIICBL0A2L0BSa�a`��0DI
pIICBL0A3L0BSa�a`��0DI
pIICBL0A4L0BSa�a`��0DI
pIICBL0A5L0BSa�a`��0DI
pIICBL0A6L0BSa�a`��0DI
pIICBL0A7L0BSa�a`��0DI
pIICBL0A8L0BSa�a`��0DI
	pIICBL0A9L0BSa�a`��0DI

pIICBL0AAL0BSa�a`��0DI
pIICBL0ABL0BSa�a`�FSSDB PAR_@
l iV9��� ���  pL0DV�AR_ pL0CV�AR_ pCDIV�AR_
 pL0LU�AR_
 pL0NL�AR_
 pL0EE�AR_
N pL0VC�AR_
O pL0FS�AR_
R pL0DG�AR_
T �AR_
VDAT_pL0CKDAT_pL0CL�AR_
Z �AR_IO_DSM��
�*�(tA�_�y�� �� �����BUF_
pL0M0�UF_ pL0M1�UF_ pL0M2�UF_
 pL0M3�UF_
 pL0M4�UF_
 pL0M5�UF_
 pL0M6�UF_
 pL0M7�UF_
 pL0M8�UF_
 pL0M9�UF_
	 pL0MA�UF_

 pL0MB�UF_
 pL0MC�UF_
 pL0MD�UF_
 pL0ME�UF_
 pL0MF�UF_
 �BUF_��
�X}�G�v1vAK�� �� �����DSMB
4�SMB I2CC�SMB
DEV0�SMB
DEV1�SMB
DEV2�SMB
DEV3�SMB
DEV4�SMB
DEV5�SMB
DEV6�SMB
 DEV7�SMB
$DEV8�SMB
(DEV9�SMB
,DEVA�SMB
0DEVBpL0DII2CCpDSMIL0D0L0A0 L0BSDEV0pDSMIL0D1L0A1 L0BSDEV1pDSMIL0D2L0A2
L0BSDEV2pDSMIL0D3L0A3 L0BSDEV3pDSMIL0D4L0A4 L0BSDEV4pDSMIL0D5L0A5
L0BSDEV5pDSMIL0D6L0A6 L0BSDEV6pDSMIL0D7L0A7 L0BSDEV7pDSMIL0D8L0A8
L0BSDEV8pDSMIL0D9L0A9 L0BSDEV9pDSMIL0DAL0AA L0BSDEVApDSMIL0DBL0AB L0BSDEVB�SMB�
��
Iu%&q�L�ĉ�H�� �� �
�����0DI��
��0DI �SMIL0D0L0A0 L0BS����
��0DI�SMIL0D1L0A1 L0BS����
��0DI
�SMIL0D2L0A2 L0BS����
��0DI
�SMIL0D3L0A3 L0BS����
��0DI
�SMIL0D4L0A4 L0BS����
��0DI
�SMIL0D5L0A5 L0BS����
��0DI
�SMIL0D6L0A6 L0BS����
��0DI
�SMIL0D7L0A7 L0BS����
	��0DI
�SMIL0D8L0A8 L0BS����

��0DI
	�SMIL0D9L0A9 L0BS����
��0DI

�SMIL0DAL0AA L0BS����
��0DI
�SMIL0DBL0AB L0BS���[��NK1_ADR _STA �L1EN���_DEP
�L1EN�DEPL1CL��PCI0_UID_HID �CID_CID �CIDF_DDN BUF_
pL1M0�UF_ pL1M1�UF_ pL1M2�UF_
 pL1M3�UF_
 pL1M4�UF_
 pL1M5�UF_
 pL1M6�UF_
 pL1M7�UF_
 pL1M8�UF_
 pL1M9�UF_
	 pL1MA�UF_

 pL1MB�UF_
 pL1MC�UF_
 pL1MD�UF_
 pL1ME�UF_
 pL1MF�UF_
 �BUF_�_PLDPLDB
� i  ���LDB
BPOSpL1PLBPOS�LDBC_CRS p
y `��1DI pIICBL1A0L1BSa�a`��1DIpIICBL1A1L1BSa�a`��1DI
pIICBL1A2L1BSa�a`��1DI
pIICBL1A3L1BSa�a`��1DI
pIICBL1A4L1BSa�a`��1DI
pIICBL1A5L1BSa�a`��1DI
pIICBL1A6L1BSa�a`��1DI
pIICBL1A7L1BSa�a`��1DI
pIICBL1A8L1BSa�a`��1DI
	pIICBL1A9L1BSa�a`��1DI

pIICBL1AAL1BSa�a`��1DI
pIICBL1ABL1BSa�a`�FSSDB PAR_@
l iV9��� ���  pL1DV�AR_ pL1CV�AR_ pCDIV�AR_
 pL1LU�AR_
 pL1NL�AR_
 pL1EE�AR_
N pL1VC�AR_
O pL1FS�AR_
R pL1DG�AR_
T �AR_
VDAT_pL1CKDAT_pL1CL�AR_
Z �AR_IO_DSM��
�*�(tA�_�y�� �� �����BUF_
pL1M0�UF_ pL1M1�UF_ pL1M2�UF_
 pL1M3�UF_
 pL1M4�UF_
 pL1M5�UF_
 pL1M6�UF_
 pL1M7�UF_
 pL1M8�UF_
 pL1M9�UF_
	 pL1MA�UF_

 pL1MB�UF_
 pL1MC�UF_
 pL1MD�UF_
 pL1ME�UF_
 pL1MF�UF_
 �BUF_��
�X}�G�v1vAK�� �� �����DSMB
4�SMB I2CC�SMB
DEV0�SMB
DEV1�SMB
DEV2�SMB
DEV3�SMB
DEV4�SMB
DEV5�SMB
DEV6�SMB
 DEV7�SMB
$DEV8�SMB
(DEV9�SMB
,DEVA�SMB
0DEVBpL1DII2CCpDSMIL1D0L1A0 L1BSDEV0pDSMIL1D1L1A1 L1BSDEV1pDSMIL1D2L1A2
L1BSDEV2pDSMIL1D3L1A3 L1BSDEV3pDSMIL1D4L1A4 L1BSDEV4pDSMIL1D5L1A5
L1BSDEV5pDSMIL1D6L1A6 L1BSDEV6pDSMIL1D7L1A7 L1BSDEV7pDSMIL1D8L1A8
L1BSDEV8pDSMIL1D9L1A9 L1BSDEV9pDSMIL1DAL1AA L1BSDEVApDSMIL1DBL1AB L1BSDEVB�SMB�
��
Iu%&q�L�ĉ�H�� �� �
�����1DI��
��1DI �SMIL1D0L1A0 L1BS����
��1DI�SMIL1D1L1A1 L1BS����
��1DI
�SMIL1D2L1A2 L1BS����
��1DI
�SMIL1D3L1A3 L1BS����
��1DI
�SMIL1D4L1A4 L1BS����
��1DI
�SMIL1D5L1A5 L1BS����
��1DI
�SMIL1D6L1A6 L1BS����
��1DI
�SMIL1D7L1A7 L1BS����
	��1DI
�SMIL1D8L1A8 L1BS����

��1DI
	�SMIL1D9L1A9 L1BS����
��1DI

�SMIL1DAL1AA L1BS����
��1DI
�SMIL1DBL1AB L1BS���[��NK2_ADR _STA �L2EN���_DEP �L2EN�DEPL2CL��PCI0_UID
_HID �CID
_CID �CID
F_DDN BUF_
pL2M0�UF_ pL2M1�UF_ pL2M2�UF_
 pL2M3�UF_
 pL2M4�UF_
 pL2M5�UF_
 pL2M6�UF_
 pL2M7�UF_
 pL2M8�UF_
 pL2M9�UF_
	 pL2MA�UF_

 pL2MB�UF_
 pL2MC�UF_
 pL2MD�UF_
 pL2ME�UF_
 pL2MF�UF_
 �BUF_�_PLDPLDB
� i  ���LDB
BPOSpL2PLBPOS�LDBC_CRS p
y `��2DI pIICBL2A0L2BSa�a`��2DIpIICBL2A1L2BSa�a`��2DI
pIICBL2A2L2BSa�a`��2DI
pIICBL2A3L2BSa�a`��2DI
pIICBL2A4L2BSa�a`��2DI
pIICBL2A5L2BSa�a`��2DI
pIICBL2A6L2BSa�a`��2DI
pIICBL2A7L2BSa�a`��2DI
pIICBL2A8L2BSa�a`��2DI
	pIICBL2A9L2BSa�a`��2DI

pIICBL2AAL2BSa�a`��2DI
pIICBL2ABL2BSa�a`�FSSDB PAR_@
l iV9��� ���  pL2DV�AR_ pL2CV�AR_ pCDIV�AR_
 pL2LU�AR_
 pL2NL�AR_
 pL2EE�AR_
N pL2VC�AR_
O pL2FS�AR_
R pL2DG�AR_
T �AR_
VDAT_pL2CKDAT_pL2CL�AR_
Z �AR_IO_DSM��
�*�(tA�_�y�� �� �����BUF_
pL2M0�UF_ pL2M1�UF_ pL2M2�UF_
 pL2M3�UF_
 pL2M4�UF_
 pL2M5�UF_
 pL2M6�UF_
 pL2M7�UF_
 pL2M8�UF_
 pL2M9�UF_
	 pL2MA�UF_

 pL2MB�UF_
 pL2MC�UF_
 pL2MD�UF_
 pL2ME�UF_
 pL2MF�UF_
 �BUF_��
�X}�G�v1vAK�� �� �����DSMB
4�SMB I2CC�SMB
DEV0�SMB
DEV1�SMB
DEV2�SMB
DEV3�SMB
DEV4�SMB
DEV5�SMB
DEV6�SMB
 DEV7�SMB
$DEV8�SMB
(DEV9�SMB
,DEVA�SMB
0DEVBpL2DII2CCpDSMIL2D0L2A0 L2BSDEV0pDSMIL2D1L2A1 L2BSDEV1pDSMIL2D2L2A2
L2BSDEV2pDSMIL2D3L2A3 L2BSDEV3pDSMIL2D4L2A4 L2BSDEV4pDSMIL2D5L2A5
L2BSDEV5pDSMIL2D6L2A6 L2BSDEV6pDSMIL2D7L2A7 L2BSDEV7pDSMIL2D8L2A8
L2BSDEV8pDSMIL2D9L2A9 L2BSDEV9pDSMIL2DAL2AA L2BSDEVApDSMIL2DBL2AB L2BSDEVB�SMB�
��
Iu%&q�L�ĉ�H�� �� �
�����2DI��
��2DI �SMIL2D0L2A0 L2BS����
��2DI�SMIL2D1L2A1 L2BS����
��2DI
�SMIL2D2L2A2 L2BS����
��2DI
�SMIL2D3L2A3 L2BS����
��2DI
�SMIL2D4L2A4 L2BS����
��2DI
�SMIL2D5L2A5 L2BS����
��2DI
�SMIL2D6L2A6 L2BS����
��2DI
�SMIL2D7L2A7 L2BS����
	��2DI
�SMIL2D8L2A8 L2BS����

��2DI
	�SMIL2D9L2A9 L2BS����
��2DI

�SMIL2DAL2AA L2BS����
��2DI
�SMIL2DBL2AB L2BS���[��NK3_ADR _STA �L3EN���_DEP �L3EN�DEPL3CL��PCI0_UID
_HID �CID
_CID �CID
F_DDN BUF_
pL3M0�UF_ pL3M1�UF_ pL3M2�UF_
 pL3M3�UF_
 pL3M4�UF_
 pL3M5�UF_
 pL3M6�UF_
 pL3M7�UF_
 pL3M8�UF_
 pL3M9�UF_
	 pL3MA�UF_

 pL3MB�UF_
 pL3MC�UF_
 pL3MD�UF_
 pL3ME�UF_
 pL3MF�UF_
 �BUF_�_PLDPLDB
� i  ���LDB
BPOSpL3PLBPOS�LDBC_CRS p
y `��3DI pIICBL3A0L3BSa�a`��3DIpIICBL3A1L3BSa�a`��3DI
pIICBL3A2L3BSa�a`��3DI
pIICBL3A3L3BSa�a`��3DI
pIICBL3A4L3BSa�a`��3DI
pIICBL3A5L3BSa�a`��3DI
pIICBL3A6L3BSa�a`��3DI
pIICBL3A7L3BSa�a`��3DI
pIICBL3A8L3BSa�a`��3DI
	pIICBL3A9L3BSa�a`��3DI

pIICBL3AAL3BSa�a`��3DI
pIICBL3ABL3BSa�a`�FSSDB PAR_@
l iV9��� ���  pL3DV�AR_ pL3CV�AR_ pCDIV�AR_
 pL3LU�AR_
 pL3NL�AR_
 pL3EE�AR_
N pL3VC�AR_
O pL3FS�AR_
R pL3DG�AR_
T �AR_
VDAT_pL3CKDAT_pL3CL�AR_
Z �AR_IO_DSM��
�*�(tA�_�y�� �� �����BUF_
pL3M0�UF_ pL3M1�UF_ pL3M2�UF_
 pL3M3�UF_
 pL3M4�UF_
 pL3M5�UF_
 pL3M6�UF_
 pL3M7�UF_
 pL3M8�UF_
 pL3M9�UF_
	 pL3MA�UF_

 pL3MB�UF_
 pL3MC�UF_
 pL3MD�UF_
 pL3ME�UF_
 pL3MF�UF_
 �BUF_��
�X}�G�v1vAK�� �� �����DSMB
4�SMB I2CC�SMB
DEV0�SMB
DEV1�SMB
DEV2�SMB
DEV3�SMB
DEV4�SMB
DEV5�SMB
DEV6�SMB
 DEV7�SMB
$DEV8�SMB
(DEV9�SMB
,DEVA�SMB
0DEVBpL3DII2CCpDSMIL3D0L3A0 L3BSDEV0pDSMIL3D1L3A1 L3BSDEV1pDSMIL3D2L3A2
L3BSDEV2pDSMIL3D3L3A3 L3BSDEV3pDSMIL3D4L3A4 L3BSDEV4pDSMIL3D5L3A5
L3BSDEV5pDSMIL3D6L3A6 L3BSDEV6pDSMIL3D7L3A7 L3BSDEV7pDSMIL3D8L3A8
L3BSDEV8pDSMIL3D9L3A9 L3BSDEV9pDSMIL3DAL3AA L3BSDEVApDSMIL3DBL3AB L3BSDEVB�SMB�
��
Iu%&q�L�ĉ�H�� �� �
�����3DI��
��3DI �SMIL3D0L3A0 L3BS����
��3DI�SMIL3D1L3A1 L3BS����
��3DI
�SMIL3D2L3A2 L3BS����
��3DI
�SMIL3D3L3A3 L3BS����
��3DI
�SMIL3D4L3A4 L3BS����
��3DI
�SMIL3D5L3A5 L3BS����
��3DI
�SMIL3D6L3A6 L3BS����
��3DI
�SMIL3D7L3A7 L3BS����
	��3DI
�SMIL3D8L3A8 L3BS����

��3DI
	�SMIL3D9L3A9 L3BS����
��3DI

�SMIL3DAL3AA L3BS����
��3DI
�SMIL3DBL3AB L3BS�����CHVSPTL��SDWE I/_SB_PCI0PSDCH_CRS ��SYS��
y RBUFF
R�     '  ( \_SB.PCI0.GPI0 �    ( \_SB.PCI0.GPI0 y �BUF
SDIP�BUF
?SDGP��DWEpGNUM SDIPpGNUM SDGP��DWE
pGNUM SDIPpGNUM SDGP�BUF[�GNS  �w [�LGNS RES0WMIF _S0_
�SS1__S1_ �SS3__S3_
 �SS4__S4_
 _S5_
  PTS_�hWAK_UEFI6 LENOVOCB-01  ACPI  5��G����6 $BVDT$ $ $CDCN27WW
$Skylake $05.05.26 ���������������������������������������������������E$ �  $
>  $ ��$_MSC_VER=@$VEREXBVersion0,BVersion1,BVersion2
$PRODEXBY511,BY513,BY710 $CCBVEXCVersion0,CVersion1,CVersion2 $RDATE$ESRT
'c=S�u|I�(�� $ENDOFBVDT�����EFIB �ENOVOCB-01  ACPI  ���L����6  MSDMU
�NOVOCB-01  ACPI     YNGHP-W2BMB-RRCGW-WH7Y2-TMVCMSSDTQ �NOVOCB-01  ACPI
 [�ANV ��[�"SANVASLB
IMONIGDSIBTTIPATIPSCIBIAISSCIDMSIF1EHVCOGSMIPAVPCADLCSTENSTENDIDDID1
DID2 DID3 DID4 DID5 DID6 DID7 DID8 DID9 DIDA DIDB DIDC DIDD DIDE DIDF DIDX NXD1
NXD2 NXD3 NXD4 NXD5 NXD6 NXD7 NXD8 NXDX LIDSKSV0
KSV1BRTLALSEALAFLLOWLHIHALFPIMTPEDPVSGMDSGFLSGGPHRE0HRG0
HRA0PWE0PWG0 PWA0P1GPHRE1HRG1 HRA1PWE1PWG1 PWA1P2GPHRE2HRG2
HRA2PWE2PWG2 PWA2DLPWDLHREECPXBAS GBASNVGA NVHA AMDA
LTRXOBFXLTRYOBFYLTRZOBFZSMSLSNSLP0UBP1UBP2UBPCSLPBGEM64B@M64L@CPEX
EEC1EEC2SBN0SBN1SBN2M32B M32L P0WK P1WK P2WK \._SB_PCI0LTRS OBFS O
\_GPE7P0L6 �\._SB_ISMEP0WK\._SB_SHPOP0WK�/_SB_PCI0PEG0
7P1L6 �\._SB_ISMEP1WK\._SB_SHPOP1WK�/_SB_PCI0PEG1
7P2L6 �\._SB_ISMEP2WK\._SB_SHPOP2WK�/_SB_PCI0PEG2
G%\/_SB_PCI0PEG0[�EGR
�0[�PEGR PSTS OGENG PMEG_PRW �PRW
i
HPMEpPSTS_PRT �PICM�R02�R02_INI pLTRXLTRSpOBFXOBFSLTRV G_DSM_T_0
��
��S5zM���M�p� _T_0��T_0 p `��i
�LTRS}`
@`�OBFS}`
`��i
�ECR1}` `�ECR1}` `��` }``����T_0
��i
�OBFS�
  ��
 ���T_0
��i
�LTRSp{zSMSL


 �TRV p{SMSL�LTRV p{zSNSL


 �TRV
 p{SNSL�LTRV
 �TRV�����T_0
��CR1��i
����T_0
	��CR1��i
�P��� ;P0EW �WKEN��SGGP ��GGP\._SB_SGOVP0WK\._SB_SHPOP0WK
B\/_SB_PCI0PEG0PEGP[�CIS  [�PCIS PVIDPDID_PRW �PRW
i
M%\/_SB_PCI0PEG1WKEN [�EGR
�0[�PEGR PSTS OGENG PMEG_PRW �PRW
i
HPMEpPSTS_PRT �PICM�R0A�R0A_INI pLTRYLTRSpOBFYOBFSLTRV G_DSM_T_0
��
��S5zM���M�p� _T_0��T_0 p `��i
�LTRS}`
@`�OBFS}`
`��i
�ECR1}` `�ECR1}` `��` }``����T_0
��i
�OBFS�
  ��
 ���T_0
��i
�LTRSp{zSMSL


 �TRV p{SMSL�LTRV p{zSNSL


 �TRV
 p{SNSL�LTRV
 �TRV�����T_0
��CR1��i
����T_0
	��CR1��i
�P��� ;P1EW �WKEN��P1GP ��1GP\._SB_SGOVP1WK\._SB_SHPOP1WK
B\/_SB_PCI0PEG1PEGP[�CIS  [�PCIS PVIDPDID_PRW �PRW
i
M%\/_SB_PCI0PEG2WKEN [�EGR
�0[�PEGR PSTS OGENG PMEG_PRW �PRW
i
HPMEpPSTS_PRT �PICM�R0B�R0B_INI pLTRZLTRSpOBFZOBFSLTRV G_DSM_T_0
��
��S5zM���M�p� _T_0��T_0 p `��i
�LTRS}`
@`�OBFS}`
`��i
�ECR1}` `�ECR1}` `��` }``����T_0
��i
�OBFS�
  ��
 ���T_0
��i
�LTRSp{zSMSL


 �TRV p{SMSL�LTRV p{zSNSL


 �TRV
 p{SNSL�LTRV
 �TRV�����T_0
��CR1��i
����T_0
	��CR1��i
�P��� ;P2EW �WKEN��P2GP ��2GP\._SB_SGOVP2WK\._SB_SHPOP2WK
B\/_SB_PCI0PEG2PEGP[�CIS  [�PCIS PVIDPDID_PRW �PRW
i
�\/_SB_PCI0GFX0&_DOSp{h
 DSEN��h
 �[HDOS HDOS�_DOD ��MTPpNDID�p NDID��DIDL pSDDLDIDLDID1��DDL2
pSDDLDDL2DID2��DDL3 pSDDLDDL3DID3��DDL4 pSDDLDDL4DID4��DDL5 pSDDLDDL5DID5��DDL6
pSDDLDDL6DID6��DDL7 pSDDLDDL7DID7��DDL8 pSDDLDDL8DID8��DDL9 pSDDLDDL9DID9��DD10
pSDDLDD10DIDA��DD11 pSDDLDD11DIDB��DD12 pSDDLDD12DIDC��DD13 pSDDLDD13DIDD��DD14
pSDDLDD14DIDE��DD15 pSDDLDD15DIDF��DIDTMP1���MTPp � �MP1 �p}  DID1 �MP1
�MP1��DID
TMP2��p}  DID1 �MP2 ��MTPp � �MP2 �p}  DID2 �MP2 �MP2��DID
TMP3���p}  DID1 �MP3 p}  DID2 �MP3 ��MTPp � �MP3
 �p}  DID3 �MP3
 �MP3� �DID
TMP4����p}  DID1 �MP4 p}  DID2 �MP4 p}  DID3 �MP4
 ��MTPp � �MP4
 �p}  DID4 �MP4
 �MP4�
�DID
TMP5�����p}  DID1 �MP5 p}  DID2 �MP5 p}  DID3 �MP5
 p}  DID4 �MP5
 ��MTPp � �MP5
 �p}  DID5 �MP5
 �MP5��DID
TMP6 ������p}  DID1 �MP6 p}  DID2 �MP6 p}  DID3 �MP6
 p}  DID4 �MP6
 p}  DID5 �MP6
 ��MTPp � �MP6
 �p}  DID6 �MP6
 �MP6��DID
TMP7%�������p}  DID1 �MP7 p}  DID2 �MP7 p}  DID3 �MP7
 p}  DID4 �MP7
 p}  DID5 �MP7
 p}  DID6 �MP7
 ��MTPp � �MP7
 �p}  DID7 �MP7
 �MP7��DID
TMP8*��������p}  DID1 �MP8 p}  DID2 �MP8 p}  DID3 �MP8
 p}  DID4 �MP8
 p}  DID5 �MP8
 p}  DID6 �MP8
 p}  DID7 �MP8
 ��MTPp � �MP8
 �p}  DID8 �MP8
 �MP8��DID
	TMP9/ ���������p}  DID1 �MP9 p}  DID2 �MP9 p}  DID3 �MP9
 p}  DID4 �MP9
 p}  DID5 �MP9
 p}  DID6 �MP9
 p}  DID7 �MP9
 p}  DID8 �MP9
 ��MTPp � �MP9
 �p}  DID9 �MP9
 �MP9��DID

TMPA4
����������p}  DID1 �MPA p}  DID2 �MPA p}  DID3 �MPA
 p}  DID4 �MPA
 p}  DID5 �MPA
 p}  DID6 �MPA
 p}  DID7 �MPA
 p}  DID8 �MPA
 p}  DID9 �MPA
 ��MTPp � �MPA
	 �p}  DIDA �MPA
	 �MPA��DID
TMPB9�����������p}  DID1 �MPB p}  DID2 �MPB p}  DID3 �MPB
 p}  DID4 �MPB
 p}  DID5 �MPB
 p}  DID6 �MPB
 p}  DID7 �MPB
 p}  DID8 �MPB
 p}  DID9 �MPB
 p}  DIDA �MPB
	 ��MTPp � �MPB

 �p}  DIDB �MPB

 �MPB��DID
TMPC>������������p}  DID1 �MPC p}  DID2 �MPC p}  DID3
�MPC
 p}  DID4 �MPC
 p}  DID5 �MPC
 p}  DID6 �MPC
 p}  DID7 �MPC
 p}  DID8 �MPC
 p}  DID9 �MPC
 p}  DIDA �MPC
	 p}  DIDB �MPC

 ��MTPp � �MPC
 �p}  DIDC �MPC
 �MPC��DID
TMPDD�������������p}  DID1 �MPD p}  DID2 �MPD p}  DID3 �MPD
 p}  DID4 �MPD
 p}  DID5 �MPD
 p}  DID6 �MPD
 p}  DID7 �MPD
 p}  DID8 �MPD
 p}  DID9 �MPD
 p}  DIDA �MPD
	 p}  DIDB �MPD

 p}  DIDC �MPD
 ��MTPp � �MPD
 �p}  DIDD �MPD
 �MPD��DID
TMPEI��������������p}  DID1 �MPE p}  DID2 �MPE p}  DID3
�MPE
 p}  DID4 �MPE
 p}  DID5 �MPE
 p}  DID6 �MPE
 p}  DID7 �MPE
 p}  DID8 �MPE
 p}  DID9 �MPE
 p}  DIDA �MPE
	 p}  DIDB �MPE

 p}  DIDC �MPE
 p}  DIDD �MPE
 ��MTPp � �MPE
 �p}  DIDE �MPE
 �MPE��DID
TMPFN���������������p}  DID1 �MPF p}  DID2 �MPF p} 
DID3 �MPF
 p}  DID4 �MPF
 p}  DID5 �MPF
 p}  DID6 �MPF
 p}  DID7 �MPF
 p}  DID8 �MPF
 p}  DID9 �MPF
 p}  DIDA �MPF
	 p}  DIDB �MPF

 p}  DIDC �MPF
 p}  DIDD �MPF
 p}  DIDE �MPF
 ��MTPp � �MPF
 �p}  DIDF �MPF
 �MPF��DID
TMPGC����������������p}  DID1 �MPG p}  DID2 �MPG p} 
DID3 �MPG
 p}  DID4 �MPG
 p}  DID5 �MPG
 p}  DID6 �MPG
 p}  DID7 �MPG
 p}  DID8 �MPG
 p}  DID9 �MPG
 p}  DIDA �MPG
	 p}  DIDB �MPG

 p}  DIDC �MPG
 p}  DIDD �MPG
 p}  DIDE �MPG
 p}  DIDF �MPG
 p � �MPG
 �MPG� [� DD01F_ADR�� DID1  pEDPVpNXD1NXDXpDID1DIDX���ID1 ����D1
_DCS �DDSDID1(_DGS ��{SGMD
 [SNXD �XD1�DDSDID1_DSSDSSTh[� DD02I_ADR�� DID2  p
EDPVpNXD2NXDXpDID2DIDX���ID2 ����D2 _DCS ��IDS ��DDSDID2(_DGS ��{SGMD
 [SNXD �XD2�DDSDID2_DSSDSSTh[�
DD03I_ADR�� DID3  p
EDPVpNXD3NXDXpDID3DIDX���ID3 ����D3 _DCS ��ID3 ���DDSDID3(_DGS ��{SGMD
 [SNXD �XD3�DDSDID3_DSSDSSTh[�
DD04I_ADR�� DID4  p
EDPVpNXD4NXDXpDID4DIDX���ID4 ����D4 _DCS ��ID4 ���DDSDID4(_DGS ��{SGMD
 [SNXD �XD4�DDSDID4_DSSDSSTh[�
DD05I_ADR�� DID5  p
EDPVpNXD5NXDXpDID5DIDX���ID5 ����D5 _DCS ��ID5 ���DDSDID5(_DGS ��{SGMD
 [SNXD �XD5�DDSDID5_DSSDSSTh[�
DD06I_ADR�� DID6  p
EDPVpNXD6NXDXpDID6DIDX���ID6 ����D6 _DCS ��ID6 ���DDSDID6(_DGS ��{SGMD
 [SNXD �XD6�DDSDID6_DSSDSSTh[�
DD07I_ADR�� DID7  p
EDPVpNXD7NXDXpDID7DIDX���ID7 ����D7 _DCS ��ID7 ���DDSDID7(_DGS ��{SGMD
 [SNXD �XD7�DDSDID7_DSSDSSTh[�
DD08I_ADR�� DID8  p
EDPVpNXD8NXDXpDID8DIDX���ID8 ����D8 _DCS ��ID8 ���DDSDID8(_DGS ��{SGMD
 [SNXD �XD8�DDSDID8_DSSDSSTh[�
DD09I_ADR�� DID9  p
	EDPVpNXD8NXDXpDID9DIDX� ��ID9 � ���D9 _DCS ��ID9 ���DDSDID9(_DGS
	��{SGMD
 [SNXD �XD8�DDSDID9_DSSDSSTh[�
DD0AI_ADR�� DIDA  p

EDPVpNXD8NXDXpDIDADIDX�
��IDA �
���DA _DCS ��IDA ���DDSDIDA(_DGS ��{SGMD
 [SNXD �XD8�DDSDIDA_DSSDSSTh[�
DD0BI_ADR�� DIDB  p
EDPVpNXD8NXDXpDIDBDIDX���IDB ����DB _DCS ��IDB ���DDSDIDB(_DGS ��{SGMD
 [SNXD �XD8�DDSDIDB_DSSDSSTh[�
DD0CI_ADR�� DIDC  p
EDPVpNXD8NXDXpDIDCDIDX���IDC ����DC _DCS ��IDC ���DDSDIDC(_DGS ��{SGMD
 [SNXD �XD8�DDSDIDC_DSSDSSTh[�
DD0DI_ADR�� DIDD  p
EDPVpNXD8NXDXpDIDDDIDX���IDD ����DD _DCS ��IDD ���DDSDIDD(_DGS ��{SGMD
 [SNXD �XD8�DDSDIDD_DSSDSSTh[�
DD0EI_ADR�� DIDE  p
EDPVpNXD8NXDXpDIDEDIDX���IDE ����DE _DCS ��IDE ���DDSDIDE(_DGS ��{SGMD
 [SNXD �XD8�DDSDIDE_DSSDSSTh[�
DD0FI_ADR�� DIDF  p
EDPVpNXD8NXDXpDIDFDIDX���IDF ����DF _DCS ��IDC ���DDSDIDF(_DGS ��{SGMD
 [SNXD �XD8�DDSDIDF_DSSDSSTh[�DD1F_ADR��DPV ����DX _DCS ��DPV
���DDSDIDX(_DGS ��{SGMD
 [SNXD �XDX�DDSDIDX_DSSDSSThH_BCL ��SYS��BCL7�Og
P
2 
































!
"
#
$
%
&
'
(
)
*
+
,
-
.
/
0
1
2
3
4
5
6
7
8
9
:
;
<
=
>
?
@
A
B
C
D
E
F
G
H
I
J
K
L
M
N
O
P
Q
R
S
T
U
V
W
X
Y
Z
[
\
]
^
_
`
a
b
c
d-_BCM��� �h
d\/_SB_PCI0GFX0AINThphBRTL_BQC �RTLDSDDLuNDIDp{h `}
�a��IDL`���DL2`���DL3`���DL4`���DL5`���DL6`���DL7`���DL8`���DL9`���D10`���D11`���D12`���D13`���D14`���D15`��BCDDSp{h
`��`���ADL`���AL2`���AL3`���AL4`���AL5`���AL6`���AL7`���AL8`��HNDDSp{h
`��`���ADL`���DL2`���DL3`���DL4`���DL5`���DL6`���DL7`���DL8`��DSST��h �
�NSTECSTE0\._SB_PCI0[�CHP
@
��MCHP @
AUDE H%TASM
 [�GDP
@
��IGDP @ GIVD GUMA  GMFN  @FASLE GSSEGSSBGSES 0 CDVL  LBPC
0ASLS [�GDM ASLB [� IGDM SIGN@SIZE OVER SVER@VVER@GVER@MBOX DMOD PCON DVER@
@JDRDY CSTS CEVT @
DIDL DDL2 DDL3 DDL4 DDL5 DDL6 DDL7 DDL8 CPDL CPL2 CPL3 CPL4 CPL5 CPL6 CPL7 CPL8
CADL CAL2 CAL3 CAL4 CAL5 CAL6 CAL7 CAL8 NADL NDL2 NDL3 NDL4 NDL5 NDL6 NDL7 NDL8
ASLP TIDX CHPD CLID CDCK SXSW EVTS CNOT NRDY DDL9 DD10 DD11 DD12 DD13 DD14 DD15
CPL9 CP10 CP11 CP12 CP13 CP14 CP15 SCIEGEFCGXFCGESF PARM DSLP @zARDY ASLC
TCHE ALSI BCLP PFIT CBLV BCLM@CPFM EPFM PLUT@%PFMB CCDV PCFT SROT IUER FDSP@FDSS
STAT @#GVD1�PHED BDDC@�DBTB2

8� 
?���  pp8p� ~CDCT'
�
�M
�M 
�MSUCCNVLD
CRIT
NCRT
EQGSCI@GBDA��ESF pYPARMp GESF�UCC��ESFp�0 PARM��0ID}PARM PARMp
GESF�UCC��ESF
{PARM �RM{PARMy�DBTBIBTT
 PARM}IBTTPARMPARMp GESF�UCC��ESF
pIPSCPARM}PARMyIPAT
 PARMrPARM PARM}PARMyLIDS
 PARMrPARM  PARM}PARMyIBIA
 PARMp GESF�UCC��ESF
pGIVDPARMPARMPARM}PARMyGMFN PARM}PARM PARM}PARMyIDMS
 PARM}y��CDCTHVCO CDVL
 PARMPARMpGESF�UCC��ESF

p PARM�ISSC}PARM
PARMp GESF�UCC��ESF
pKSV0PARMpKSV1GESF�UCCp GESF�RITN/SBCB��ESF p PARMp݇ PARMp GESF�UCC��ESFp
GESFp PARM�UCC��ESF
p GESFp PARM�UCC��ESF
p GESFp PARM�UCC��ESF
p GESFp PARM�UCC��ESF
��S0ID�SYS���PARM
�GUAM��PARM
�GUAM
��ARM pCLID`�{ � {CLID
CLIDGLIDCLIDp GESFp PARM�UCC��ESF
��S0ID�SYS�p{zPARM

�
� \GUAM p GESFp PARM�UCC��ESF
	{PARM
�Tp GESFp PARM�UCC��ESF

{PARM
�C�{zPARM

�PARM

�TvIPAT{zPARM

IBIAp GESFp PARM�UCC��ESF
{zPARM IF1E�{PARM � {zPARM

IDMS�{zPARM

IDMSp GESFp PARM�UCC��ESF
p GESFp PARM�UCC��ESF
pyLIDS
 PARMrPARM PARMp GESF�UCC��ESF
�{PARM ��PARM pISSC�p GESF�RIT�p ISSCp GESFp PARM�UCC��ESF
p GESFp PARM�UCC��ESF
{PARM
PAVPp GESFp PARM�UCCp GESF�UCC��EFC
pGBDAGXFC��EFC
pSBCBGXFCp GEFCpCPSCp GSSEp SCIE�PDRD �DRDYPSTS ��STS
["ASLP�CSTS
MGNOT�PDRD�phCEVTp
CSTS��CHPD � �/_SB_PCI0GFX0i�[HNOT HNOTh��/_SB_PCI0GFX0
� GHDSphTIDX�NOT 5GLID��p
CLID�phCLID�GNOT
 }CLID �LID��GDCKphCDCK�NOT
 PARD ��RDY["ASLP�ARDY6IUEH {IUER
�UERIUERyh IUER��h
�INT
 ��INTh OAINT��TCHEyh ��PARD����
�h
pyh ASLCpASLEp b��b
�SLC ["
ub���
� CPFM{CPFM
`{EPFM
a���{a
 p
PFIT��{a
 p
PFIT�pPFIT��
�{a
 p
PFIT��{a pPFIT�p
PFIT��
�{a pPFIT��{a
 p
PFIT�p
PFIT�PFIT
PFIT}PFIT �FITp
ASLC���pxwi
� BCLP}BCLP �CLPp
ASLC��� piALSIpASLC��pASLE�GK_DSM_T_0 �J�
�[>�����KHp� _T_0��T_0 ��piGfx Supported Functions Bitmap [1���D� �T_0�
�p Adapter Power State Notification [1��S0ID�SYS����k
�GUAMp{�k
�� \GUAM
��� pCLID`�{ � {CLID
CLIDGLIDCLID��:��T_0
��pDisplay Power State Notification [1��S0ID�SYS�p{�k
�
� \GUAM ��4��T_0
��pBIOS POST Completion Notification [1��0��T_0
��pPre-Hires Set Mode [1��-��T_0
��pPost-Hires Set Mode [1��+��T_0
��pSetDisplayDeviceNotification [1��'��T_0
��pSetBootDevicePreference [1{�k
�T��$��T_0
��pSetPanelPreference [1{�k
�C�{�k
��
�TvIPAT{z�k


IBIA����T_0
	��pFullScreenDOS [1����T_0

��pAPM Complete [1pyLIDS
 `r` `����T_0
��pGetBootDisplayPreference [1}y�k

 y�k

 `{` �`y�DBTBIBTT
 `}IBTT``����T_0
��pGetPanelDetails [1pIPSC`}`yIPAT
 `r` `}`yLIDS
 `r`  `}`yIBIA
 `����T_0
��pGetInternalGraphics [1pGIVD```}`yGMFN `}` `}`yIDMS
 `}y��CDCTHVCO CDVL
 ``����T_0
��pGetAKSV [1KSVP
 � �KSV0�SVP pKSV1�SVP �SVP� <\_SB_[�SKC0_HIDINT3470 _CIDA�_STA
��MTP
���5\/_SB_PCI0GFX0[�SKC0_ADR �_STA ��MTP����\._SB_PCI0HBRB HBRD HBRF
IVID�EBA PION PIOF PBUS PDEV PFUN EBUS EDEV EFN0 EFN1INDX POFF PLEN
VIOF DSOF
CPOF
4SBOF
ELC0 ECP0�H0VI H0DI ELC1 ECP1�H1VI H1DI ELC2 ECP2�H2VI H2DI TIDX
OTSD MXPG
FBDL CBDL MBDL HSTR LREV TCNT LDLY,[�PG0 rXBAS � [�OPG0 P0VIP0DI
DSO0 @CPO0 H= P0LD K P0L2P0L0 I. P0VC N| P0LS L Q0L2Q0L0 �HST0
P0TR � BSP1 @ BSP2 @ BSP3 @ BSP4 @ BSP5 @ BSP6 @ BSP7 @
BSP8 � P0AP J P0RM LP0LT LKLRV0 [�CS0 rXBASySBN0

�PCS0D0VI @S0VIS0DI[�AP0 rrXBASySBN0
 EECP
[�CAP0 @LCP0 LCT0[�PG1 rXBAS � [�OPG1 P1VIP1DI DSO1 @CPO1 H= P1LD
K P1L2P1L0 I. P1VC N| P1LS L Q1L2Q1L0 �HST1 P1TR � P1AP J P1RM
LP1LT LKLRV1 [�CS1 rXBASySBN1

�PCS1D1VI @S1VIS1DI[�AP1 rrXBASySBN1
 EEC1
[�CAP1 @LCP1 LCT1[�PG2 rXBAS � [�OPG2 P2VIP2DI DSO2 @CPO2 H= P2LD
K P2L2P2L0 I. P2VC N| P2LS L Q2L2Q2L0 �HST2 P2TR � P2AP J P2RM
LP2LT LKLRV2 [�CS2 rXBASySBN2

�PCS2D2VI @S2VIS2DI[�AP2 rrXBASySBN2
 EEC2
[�CAP2 @LCP2 LCT2[�CD0 XBAS
�MCD0 MODI/PEGSp `��CPEX� � ��{MODI

p`�G+PGON phPION��ION ��GGP ����ION��1GP ����ION
��2GP �p\XBASPEBApGDEVPIONPDEVpGFUNPIONPFUNSCLK  ���SCLK PCRA
���CLK ["
��CHKPION �GPPRPION��SYS���ION p P0APp P0RM���IONp P1APp P1RM���ION
p P2APp P2RM��PBGE
�SBDLPIONPUABPIONpGUBCPIONCBDLpGMXBPIONMBDL��BDLMBDLpMBDLCBDLPDUBPIONCBDL��ION p
P0LDpP0TRp TCNT��CNTLDLY��0VC �"
rTCNT
TCNT���IONp P1LDpP1TRp TCNT��CNTLDLY��1VC �"
rTCNT
TCNT���ION
p P2LDpP2TRp TCNT��CNTLDLY��2VC �"
rTCNT
TCNT�LKENPION��ION pH0VIS0VIpH0DIS0DI}{ELC0
C {LCT0� LCT0���IONpH1VIS1VIpH1DIS1DI}{ELC1
C {LCT1� LCT1���ION
pH2VIS2VIpH2DIS2DI}{ELC2
C {LCT2� LCT2�C&PGOF phPIOF��IOF ��GGP ����IOF��1GP ����IOF
��2GP �p\XBASPEBApGDEVPIOFPDEVpGFUNPIOFPFUNSCLK  ��CHKPIOF ���
pLCT0ELC0pS0VIH0VIpS0DIH0DIpLCP0ECP0���pLCT1ELC1pS1VIH1VIpS1DIH1DIpLCP1ECP1���
pLCT2ELC2pS2VIH2VIpS2DIH2DIpLCP2ECP2��SYS���IOF pP0LDp TCNT��CNTLDLY��0LT
�"
rTCNT
TCNTpP0RMp
P0AP� ��IOFpP1LDp TCNT��CNTLDLY��1LT
�"
rTCNT
TCNTpP1RMp
P1AP���IOF
pP2LDp TCNT��CNTLDLY��2LT
�"
rTCNT
TCNTpP2RMp
P2AP��PBGE �SBDLPIOFpGMXBPIOFMBDLPDUBPIOFMBDL�LKDSPIOF���SCLK PCRO
��SCLK ["
GPPRPIOF ��OSYS�DIWKPIOF�AMMRBphg}gyi
 g}gyj
 g}gyk
 g}glg[�CI0 g[�PCI0TEMP�EMPBMMWBphg}gyi
 g}gyj
 g}gyk
 g}glg[�CI0 g[�PCI0TEMPpmTEMPBMMRWphg}gyi
 g}gyj
 g}gyk
 g}glg[�CI0 g
[�PCI0TEMP�EMPCMMWWphg}gyi
 g}gyj
 g}gyk
 g}glg[�CI0 g
[�PCI0TEMPpmTEMPBMMRDphg}gyi
 g}gyj
 g}gyk
 g}glg[�CI0 g
[�PCI0TEMP �EMPCMMWDphg}gyi
 g}gyj
 g}gyk
 g}glg[�CI0 g
[�PCI0TEMP pmTEMPFGULCpMMRDPEBAPBUSPDEVPFUN
�zg
g{g
?gphfzf
f{f
?f��ftgf`�p `�L GMXB�� pHST0HSTR���pHST1HSTR���
pHST2HSTRzHSTR
HSTR{HSTR
HSTR�� ��STR
p
`�p
`�����STR
p
`���STR p
`���
��STR p
`�O!PUABp FBDLp CBDL�� pHST0HSTRpLRV0LREV���pHST1HSTRpLRV1LREV���
pHST2HSTRpLRV2LREVzHSTR
HSTR{HSTR
HSTRzLREV
LREV{LREVLREV�� ��STR
p FBDLp
CBDL���REV p FBDLp
CBDL�p
FBDLp
CBDL� ����STR
��REV p
FBDLp
CBDL�p FBDLp
CBDL���STR ��REV p
FBDLp
CBDL�p
FBDLp
CBDL���
��STR ��REV p
FBDLp
CBDL�p FBDLp
CBDLpINDX��CBDL �
�INDXCBDL��0VIIVID���P0VIIVID��BDL p BSP1��BDLp BSP2��BDL
p BSP3��BDL
p BSP4��BDL
p BSP5��BDL
p BSP6��BDL
p BSP7��BDL
p BSP8uFBDLuINDX@!PDUBp FBDLpiCBDL��BDL ���
pHST0HSTRpLRV0LREV���pHST1HSTRpLRV1LREV���
pHST2HSTRpLRV2LREVzHSTR
HSTR{HSTR
HSTRzLREV
LREV{LREVLREV�� ��STR
��REV pt
CBDL FBDL�p FBDL���REV pt
CBDL FBDL�p
FBDL�����STR
��REV pt
CBDL FBDL�p FBDL���STR ��REV pt
CBDL FBDL�p
FBDL���
��STR ��REV pt
CBDL FBDL�p FBDLpINDX�
�INDXCBDL��0VIIVID���P0VIIVID��BDL pBSP1��BDLpBSP2��BDL
pBSP3��BDL
pBSP4��BDL
pBSP5��BDL
pBSP6��BDL
pBSP7��BDL
pBSP8uFBDLuINDX>SBDL�� ��0UB ������1UB ����
��2UB ����BGUBCp g�� pLCP0f���pLCP1f���
pLCP2f�� ��0UB
�LCfepxe
 g���P0UB pP0UBg�����1UB
�LCfepxe
 g���P1UB pP1UBg���
��2UB
�LCfepxe
 g���P2UB pP2UBg�ILKEN{CPEX
c�� �� pP0L0["
p `�P0L0��
�"
u`���pP1L0["
p `�P0L0��
�"
u`���
pP2L0["
p `�P0L0��
�"
u`���c �� pQ0L0["
p `�Q0L0��
�"
u`���pQ1L0["
p `�Q1L0��
�"
u`���
pQ2L0["
p `�Q2L0��
�"
u`ILKDS{CPEX
c�� �� pP0L2["
p `�P0L2��
�"
u`���pP1L2["
p `�P1L2��
�"
u`���
pP2L2["
p `�P2L2��
�"
u`���c �� pQ0L2["
p `�Q0L2��
�"
u`���pQ1L2["
p `�Q1L2��
�"
u`���
pQ2L2["
p `�Q2L2��
�"
u`DIWK�� ������
#GDEV�� p`���p`��
p`�$GFUN�� p `���p`��
p
`�JCCHK�� pP0VIg���pP1VIg���
pP2VIg��IVID���h pP0VIg��IVID��� �� ��GPISGGPPWE0PWG0PWA0
�����GPIP1GPPWE1PWG1PWA1 ���
��GPIP2GPPWE2PWG2PWA2 ������
��GPISGGPPWE0PWG0PWA0�����GPIP1GPPWE1PWG1PWA1���
��GPIP2GPPWE2PWG2PWA2��NNTFY�� �/_SB_PCI0PEG0i����/_SB_PCI0PEG1i���
�/_SB_PCI0PEG2iHGPPR� � �� SGPOSGGPHRE0HRG0HRA0SGPOSGGPPWE0PWG0PWA0
��SGPOP1GPHRE1HRG1HRA1SGPOP1GPPWE1PWG1PWA1 ��
SGPOP2GPHRE2HRG2HRA2SGPOP2GPPWE2PWG2PWA2 �����
SGPOSGGPHRE0HRG0HRA0SGPOSGGPPWE0PWG0PWA0["DLPWSGPOSGGPHRE0HRG0HRA0
["DLHR��SGPOP1GPHRE1HRG1HRA1SGPOP1GPPWE1PWG1PWA1["DLPWSGPOP1GPHRE1HRG1HRA1
["DLHR��
SGPOP2GPHRE2HRG2HRA2SGPOP2GPPWE2PWG2PWA2["DLPWSGPOP2GPHRE2HRG2HRA2
["DLHR2SGPO�� �l{ll���[\._SB_SGOV \._SB_SGOVjl5SGPI���[\._SB_GGOV
p\._SB_GGOVj`�� �`{``�DBGP4 )LENOVOCB-01  ACPI   H� @� DBG2a �ENOVOCB-01 
ACPI  ,  5  & �  "  @� \_SB.PCI0.UA02 SSDT| 0LENOVOCB-01  ACPI  F
\/_SB_PCI0XHC_RHUBNGPLD
PCKG
[�PCKG
REV_pREV_[�PCKG
@VISIphVISI[�PCKG
W
GPOSpiGPOS�CKG!GUPC PCKG
�h�CKG �CKG3\/_SB_PCI0XHC_RHUBHS01_UPC �UPC_PLD
�PLD4\/_SB_PCI0XHC_RHUBHS02_UPC �UPC_PLD �PLD
4\/_SB_PCI0XHC_RHUBHS03_UPC �UPC_PLD �PLD
3\/_SB_PCI0XHC_RHUBHS04_UPC �UPC _PLD �PLD 4\/_SB_PCI0XHC_RHUBHS05_UPC
�UPC_PLD �PLD
H\/_SB_PCI0XHC_RHUBHS06_UPC �UPC_PLD �PLD
[�WCAM _ADR�'_PLDPLDY
�   �LDY_RMV �3\/_SB_PCI0XHC_RHUBHS07_UPC �UPC _PLD �PLD
3\/_SB_PCI0XHC_RHUBHS08_UPC �UPC _PLD �PLD 3\/_SB_PCI0XHC_RHUBHS09_UPC
�UPC _PLD �PLD 3\/_SB_PCI0XHC_RHUBHS10_UPC �UPC _PLD �PLD
4\/_SB_PCI0XHC_RHUBHS11_UPC �UPC_PLD �PLD
3\/_SB_PCI0XHC_RHUBHS12_UPC �UPC _PLD �PLD 3\/_SB_PCI0XHC_RHUBHS13_UPC
�UPC _PLD �PLD 3\/_SB_PCI0XHC_RHUBHS14_UPC �UPC _PLD �PLD
3\/_SB_PCI0XHC_RHUBUSR1_UPC �UPC _PLD �PLD 3\/_SB_PCI0XHC_RHUBUSR2_UPC
�UPC _PLD �PLD 4\/_SB_PCI0XHC_RHUBSS01_UPC �UPC_PLD �PLD
4\/_SB_PCI0XHC_RHUBSS02_UPC �UPC_PLD �PLD
3\/_SB_PCI0XHC_RHUBSS03_UPC �UPC _PLD �PLD 3\/_SB_PCI0XHC_RHUBSS04_UPC
�UPC _PLD �PLD 3\/_SB_PCI0XHC_RHUBSS05_UPC �UPC _PLD �PLD
A\/_SB_PCI0XHC_RHUBSS06_UPC �UPC_PLD �PLD
[� CRGB=_STA[�HCM {MEMB �� [�XHCM �SP06��P06�� _ADR�_UPCUPCP
� �PCP+_PLDPLDY
� $  ���LDY[� CDPT=_STA[�HCM {MEMB �� [�XHCM �SP06��P06��
_ADR�_UPCUPCP
� �PCP+_PLDPLDY
� $  ���LDY3\/_SB_PCI0XHC_RHUBSS07_UPC �UPC _PLD �PLD
3\/_SB_PCI0XHC_RHUBSS08_UPC �UPC _PLD �PLD 3\/_SB_PCI0XHC_RHUBSS09_UPC
�UPC _PLD �PLD 3\/_SB_PCI0XHC_RHUBSS10_UPC �UPC _PLD �PLD ASF!� LENOVOCB-01
 ACPI   � W  , �o h� �o h � �o h �    ����  ��W 
� \h����� ASPT4 %LENOVOCB-01  ACPI  BOOT( �OVOCB-01  ACPI  D HPET8
�OVOCB-01  ACPI  ��@ � � LPIT� �ENOVOCB-01  ACPI  8  ` 0u � @ 2 8 
 ` 0u � @ 2 APIC� �ENOVOCB-01  ACPI  �        
  � 
  
		         MCFG<
		 _LENOVOCB-01  ACPI  � � SSDT� LENOVOCB-01  ACPI  O*\
		 [�*EIAD_HID%��_S0W /_STAADBGEIAD STA ��ID_
 ����IDF��B&_DSM_T_0 PECE PECD DFUE DFUD OLDV PECV DFUV �"�
<�#O�ͮ"�ϠM �� � p� _T_0��T_0 ADBGEIAD F:0 ��� �T_0ADBGEIAD F:1 ��BID_
 p�k PECEp�k PECDp\/_SB_PCI0GEXPGEPS
OLDV\/_SB_PCI0GEXPSGEP
PECE��ECD ["PECD\/_SB_PCI0GEXPSGEP
OLDV����T_0
ADBGEIAD F:2 p�k DFUEp�k DFUD��ID_
 p\._SB_GGOV OLDV\._SB_SGOV DFUE�p\._SB_GGOV OLDV\._SB_SGOV
 DFUE��FUD ["DFUD��ID_
 \._SB_SGOV OLDV�\._SB_SGOV OLDV����T_0
ADBGEIAD F:3 ��ID_
 p\._SB_GGOV DFUVpPECV�p\._SB_GGOV DFUVp\/_SB_PCI0GEXPGEPS
PECV�
PECVDFUV� ��SSDT� �NOVOCB-01  ACPI  E\/_SB_PCI0SAT0[�PRID_ADR B_GTM
PBUF
 �BUF PIO0�BUF
DMA0�BUF
PIO1�BUF
DMA1�BUF
FLAGp
�0p
�1p
DMA0p
DMA1p
FLAG�BUF_STM[�MAST_ADR [�SLAV_ADR[�SECD_ADRB_GTM PBUF
 �BUF PIO0�BUF
DMA0�BUF
PIO1�BUF
DMA1�BUF
FLAGp
�0p
�1p
DMA0p
DMA1p
FLAG�BUF_STM[�MAST_ADR [�SLAV_ADRSSDT��ENOVOCB-01  ACPI 
O<\_TZ_ETMDTHLD
xYBT4
7YBT3
@YBT2
IYBT1
PYBT0
[[�TZ00PTMP�N_TMP��TMD���[\._PR_DTSE ��._PR_DTSE
�w\CRTT

 �
[\._PR_DTSE � �._PR_DTSE��._PR_PKGAp\._PR_PDTS`��w`

 p\._PR_DTS1`��._PR_DTS2`p\._PR_DTS2`��._PR_DTS3`p\._PR_DTS3`��._PR_DTS4`p\._PR_DTS4`��w`

 �\ECONp\/_SB_PCI0LPCBEC0_CPUT`r�w`

 `p`PTMP���[�&TZ01PTMP�J_TMP��TMD���[\._PR_DTSE ��._PR_DTSE
�w\CRTT

 �
[\._PR_DTSE � �._PR_DTSE��._PR_PKGAp\._PR_PDTS`��w`

 p\._PR_DTS1`��._PR_DTS2`p\._PR_DTS2`��._PR_DTS3`p\._PR_DTS3`��._PR_DTS4`p\._PR_DTS4`��w`

 �\ECONp\/_SB_PCI0LPCBEC0_CPUT`r�``p`PTMP���MXPSL��TCNT
�C\._PR_CPU0\._PR_CPU1\._PR_CPU2\._PR_CPU3\._PR_CPU4\._PR_CPU5\._PR_CPU6\._PR_CPU7��TCNT
�*\._PR_CPU0\._PR_CPU1\._PR_CPU2\._PR_CPU3��TCNT
�\._PR_CPU0\._PR_CPU1�\._PR_CPU0HXPSV�[\._PR_APSV ��\._PR_APSV
��w\._PR_APSV

 ��w\PSVT

 XTC1�TC1VXTC2�TC2VXTSP�TSPVSSDTX �NOVOCB-01  ACPI  H\
 SSDTOCPU0IST ��� APIST �u� CPU0CST �u APCST � CPU0HWP :Wg�
 APHWP � HWPLVT �]g0 \PDC0 �\PDC1 �\PDC2 �\PDC3 �\PDC4 �\PDC5
 �\PDC6 �\PDC7 �\SDTL @\_PR_CTPC [�NVS  @i_k [�PNVSPGRVCFGD
 ACRTAPSVAAC0CPID
 CPPCCCTPCLVLCBMIPL10PL20PLW0CTC0TAR0PPC0PL11PL21PLW1CTC1TAR1PPC1PL12PL22PLW2CTC2TAR2PPC2C3MWC6MWC7MWCDMWC3LTC6LTC7LTCDLTCDLVCDPWMPMFDTSEDTS1DTS2DTSFPDTSPKGADTS3DTS4BGMA@BGMSBGIABGILDSIADSILDSAEEPCSEMNA@ELNG@HWPVHWPAHWPLPOWSHDCE[�O_D\._PR_DSIA\._PR_DSIL[�IO_DTRPD[�O_P\._PR_BGIA\._PR_BGIL[�IO_PTRPFI9\._PR_CPU0HI0_
 HC0_ HW0_ HW2_ _PDCpCPDCh`GCAP`�_OSCpCOSChijk`GCAP`�HCPDC� REVS�
SIZEp�`pt`
 a[h
@wa
 TEMPSTS0
 sSTS0TEMPb�OSC
�@)���Xq9SREVSSIZEb@COSC� STS0�
CAP0� IID0�
IID1�
IID2�
IID3UID0
�@)���Xq9S�ID0 EID0�ID0
EID1�ID0
EID2�ID0
EID3���IID0EID0�ID1EID1�IID2EID2�ID3EID3p
STS0���ip

STS0���STS0 �{CAP0 p \._PR_HDCE�[�MIP
�[�SMIPIOB2p
(IOB2�MGCAP� STS0�
CAP0��STS0
�TS0

��{STS0 {CAP0�P0�}{PDC0� CAP0PDC0�{CFGD
z ��{CFGD  {PDC0
 �SDTL
 }SDTL
SDTL[�ST0 �SSDT
 �SSDT
 [ CST0HC0_��CFGD �SDTL
 }SDTL
SDTL[�ST0 �SSDT �SSDT
 [ IST0HI0_��CFGD @ �SDTL
@ �{\._SB_OSCP
  }SDTL
@SDTL[�WP0 �SSDT
 �SSDT
 [ HWP0HW0_�{CFGD � [�WPL �SSDT
 �SSDT
 [ HWPLHW2_�{\._SB_OSCP
  ��\._SB_OSCP
@ p HWPV�{\._SB_OSCP
@ p
HWPV��PDC0  [�MIP
�[�SMIPIOB2p
'IOB2�G\._PR_CPU1HI1_ HC1_ HW1_
_PDCp\/_PR_CPU0CPDCh`GCAP`�"_OSCp\/_PR_CPU0COSChijk`GCAP`�B GCAP� STS1�
CAP1��STS1
�TS1

��{STS1 {CAP1�P1�}{PDC1� CAP1PDC1��PDC1

	APPT�{\._SB_OSCP
  HWPT�{PDC1
 APCTpPDC1PDC0�JAPCT ��CFGD
z �SDTL
  }SDTL
 SDTL[�ST1 �SSDT

 �SSDT
 [ CST1HC1_IAPPT ��CFGD �SDTL
 }SDTL
SDTL[�ST1 �SSDT
 �SSDT
 [ IST1HI1_MHWPT ��CFGD @ �SDTL
�}SDTL
�DTL[�WP1 �SSDT
 �SSDT
 [
HWP1HW1_C\._PR_CPU2_PDCp\/_PR_CPU0CPDCh`GCAP`�"_OSCp\/_PR_CPU0COSChijk`GCAP`�CGCAP�
STS2�
CAP2��STS2
�TS2

��{STS2 {CAP2�P2�}{PDC2� CAP2PDC2��PDC2

	\/_PR_CPU1APPT�{\._SB_OSCP
  \/_PR_CPU1HWPT�{PDC2

\/_PR_CPU1APCTpPDC2PDC0�C\._PR_CPU3_PDCp\/_PR_CPU0CPDCh`GCAP`�"_OSCp\/_PR_CPU0COSChijk`GCAP`�CGCAP�
STS3�
CAP3��STS3
�TS3

��{STS3 {CAP3�P3�}{PDC3� CAP3PDC3��PDC3

	\/_PR_CPU1APPT�{\._SB_OSCP
  \/_PR_CPU1HWPT�{PDC3

\/_PR_CPU1APCTpPDC3PDC0�C\._PR_CPU4_PDCp\/_PR_CPU0CPDCh`GCAP`�"_OSCp\/_PR_CPU0COSChijk`GCAP`�CGCAP�
STS4�
CAP4��STS4
�TS4

��{STS4 {CAP4�P4�}{PDC4� CAP4PDC4��PDC4

	\/_PR_CPU1APPT�{\._SB_OSCP
  \/_PR_CPU1HWPT�{PDC4

\/_PR_CPU1APCTpPDC4PDC0�C\._PR_CPU5_PDCp\/_PR_CPU0CPDCh`GCAP`�"_OSCp\/_PR_CPU0COSChijk`GCAP`�CGCAP�
STS5�
CAP5��STS5
�TS5

��{STS5 {CAP5�P5�}{PDC5� CAP5PDC5��PDC5

	\/_PR_CPU1APPT�{\._SB_OSCP
  \/_PR_CPU1HWPT�{PDC5

\/_PR_CPU1APCTpPDC5PDC0�C\._PR_CPU6_PDCp\/_PR_CPU0CPDCh`GCAP`�"_OSCp\/_PR_CPU0COSChijk`GCAP`�CGCAP�
STS6�
CAP6��STS6
�TS6

��{STS6 {CAP6�P6�}{PDC6� CAP6PDC6��PDC6

	\/_PR_CPU1APPT�{\._SB_OSCP
  \/_PR_CPU1HWPT�{PDC6

\/_PR_CPU1APCTpPDC6PDC0�C\._PR_CPU7_PDCp\/_PR_CPU0CPDCh`GCAP`�"_OSCp\/_PR_CPU0COSChijk`GCAP`�CGCAP�
STS7�
CAP7��STS7
�TS7

��{STS7 {CAP7�P7�}{PDC7� CAP7PDC7��PDC7

	\/_PR_CPU1APPT�{\._SB_OSCP
  \/_PR_CPU1HWPT�{PDC7
 \/_PR_CPU1APCTpPDC7PDC0�SSDTTC �nsydeNVOP  INTL
L\/_SB_PCI0PEG0PEGP[�BOR `�  [�VBORRVBS
VBS1�@VBS2�@VBS3�@VBS4�@VBS5�@VBS6�@VBS7�@VBS8�@C \/_SB_PCI0PEG0PEGP[�GOP ��
[�SGOPXBAS EBAS EECP DBPA SGGPSGMDPWOK HLRS DSEL ESEL PSEL PWEN PRST GBASAPDT
AHDT IHDT DSSV NVVD OPTFO\/_SB_PCI0PEG0PEGP[�OPR �w
[�NOPRDHPSDPCSGPSSVENSGC6SSLVSPBCMGPSPMXBS MXMB�SMXS
SMXB�KA\._SB_PCI0OTM_OTMACPI 2010-Mar-09 12:08:26 [�>WMI1_HIDPNP0C14
_UIDMXM2 _WDGH
��B�I�+ܩ:��b����i�� �:_�.�Oܼ��u>B��?�AS�$O�8�B�EWMMX�
FUNC��UNCMXMX�
XRG1��
�/_SB_PCI0GFX0MXMXXRG1��/_SB_PCI0PEG0PEGPMXMXXRG1���UNCMXDS�
XRG2��
�/_SB_PCI0GFX0MXDSXRG2��/_SB_PCI0PEG0PEGPMXDSXRG2�WQXMA*�FOMB �  DS
}�҃ B����0( �&&@�
����%B������J��!�����#��h�L���`�� L�Ta4E�d@ȣ �Фؽ
��p(@�kr![�hP��,*�P�����������i4�&8v�� }n9���x+��x׀��Ap�z�N༎��cgu2]��
.����l��A�̐���� x4�f�`P9J��%���zFE#k">xܖB �;�q��
���<`�>$����X0z�+ !��@��rlhx~p��M�89�������
��:���7j�|,�C��:�BD�!�'F1l����>4�tP�:������x�OP�O��|:�|:�`O�t�O��1^����=+��������5���c�����
���?���BZ\/_SB_PCI0PEG0LTRE [�PCX \/_SB_PCI0PEG0PEGPDBPA
[�RPCXPVIDPDID @T CMLW ASPM LNKDRTLK B LREN E( VCNP N| LNKS �
PCFG TREN � PRB1 @ PRB2 @ PRB3 @ PRB4 @ PRB5 @ PRB6 @
PRB7 @ PRB8 � AFES J PBSQ Li LREV=RBP0pr\/_SB_PCI0PEG0PEGPDBPAh
g[�CI0 g[�PCI0TEMP�EMPDWBP0pr\/_SB_PCI0PEG0PEGPDBPAh g[�CI0
g[�PCI0TEMPpiTEMP�EMPKBSPRprr\/_SB_PCI0PEG0PEGPDBPA wh
  g[�CI0 g
[�PCI0 TEMPpiTEMPOC7OK[�WHB \/_SB_PCI0PEG0PEGPXBAS [�MWHB @$MHEN
MHBR[�BAR ryMHBR
  P  [�MBAR � C7ADphC7ADWKEN [�EGB \/_SB_PCI0PEG0PEGPDBPA [�PEGB
PCMR H?PMST[�GRS \/_SB_PCI0PEG0PEGPEBAS
P[�DGRSDVID @SSSV [�'PG00 _STAMSD3 @_ON_��SD3
��/_SB_PCI0PEG0PEGPTDGC��/_SB_PCI0PEG0PEGPDGCX
p_STA\/_SB_PCI0PEG0PEGPGC6O���/_SB_PCI0PEG0PEGPDGCX
p_STA\/_SB_PCI0PEG0PEGPGC6Op \/_SB_PCI0PEG0PEGPTDGCp
\/_SB_PCI0PEG0PEGPDGCX�\/_SB_PCI0PEG0PEGPHGONp
PCMRp PMSTp�8SSSVp \/_SB_PCI0PEG0PEGPMLTFp_STAp MSD3p
\/_SB_PCI0LPCBEC0_GATY["

p \/_SB_PCI0PEG0PEGPMLTFI_OFF��SD3 p \/_SB_PCI0PEG0PEGPMLTFp
\/_SB_PCI0LPCBEC0_GATY["

��/_SB_PCI0PEG0PEGPTDGC[\/_SB_PCI0PEG0PEGPTGPC
GUPC��GUPC \/_SB_PCI0PEG0PEGPGC6Ip _STA���GUPC
\/_SB_PCI0PEG0PEGPGC6Ip _STA�\/_SB_PCI0PEG0PEGPHGOFp _STAp
MSD3_PR0PG00_PR2PG00_PR3PG00_PS0_PS3_S0W �{\._SB_OSCO
 ���$_DSW�ip WKEN���jpWKEN�p WKENA�/_SB_PCI0PEG0PEGPONOFIVID�CNT LDLY
dELCT FBDL MBDL CBDL HSTR UULN INDX POFF PLEN PDAT WLSB WMSB DMLW
DAT0AO�            $  (  ,  0  , @  D  H  L  P  L `
 d  h  l  p  l � � � � � � � � � � � � � � � � � � � � �
� � � 0
 
 
 
 � � � � � � � � � � � � � � � � � � � � � � � � 
 
 
 

 $
 (
 ,
 0
 4
 8
 <
 @
 D
 H
 L
 P
 T
 X
 \
 `
 d
 h
 l
 p
 t
 x
 |
 � � � � � � � �   8  X  x  � � � � $ � ` ( 8     
         "  $  &  (  ,  <  =  >  � � � � � � � � �
� � � � �  D P X \ �    ( , 8 @ D P X \ �
4 � � � � � � � � � � ��DAT1G
C ���������������[�GAR \/_SB_PCI0PEG0PEGPEBAS [�VGARVREG@�VGAB 
[�PIOGBAS
`[�GPIO @LVL0 @LVL1 @LVL2 [�CAP\/_SB_PCI0PEG0PEGPEECP
[�PCAP @ EMLW LCTL_INI p \/_SB_PCI0PEG0PEGP_ADR$GMXB pPCFGHSTR��STR
p
`�p
`�GPUAB p FBDLp CBDLpPCFGHSTR��STR
p FBDLp
CBDL���REV p FBDLp
CBDL�p
FBDLp
CBDLpINDX��CBDL ��INDXCBDLBSPRFBDL uFBDLuINDXHPDUBp FBDLphCBDL��BDL ���STR
��REV pt
CBDL FBDL�p FBDL���REV pt
CBDL FBDL�p
FBDLpINDX��INDXCBDLBSPRFBDLuFBDLuINDXH SPP0 p INDX�p�DAT0INDX
WLSBuINDXp�DAT0INDX WMSBuINDXp}yWMSB
 WLSB POFFp�DAT0INDX PLENuINDX��OFF�)�LEN pRBP0POFF�AT0INDX uINDXuPOFFvPLENH
RPP0 p INDX�p�DAT0INDX WLSBuINDXp�DAT0INDX WMSBuINDXp}yWMSB
 WLSB POFFp�DAT0INDX PLENuINDX��OFF�)�LEN WBP0POFF�DAT0INDX uINDXuPOFFvPLENH
CLP0 p INDX�p�DAT1INDX WLSBuINDXp�DAT1INDX WMSBuINDXp}yWMSB
 WLSB POFFp�DAT1INDX PLENuINDX��OFF�)�LEN WBP0POFF�DAT1INDX
uINDXuPOFFvPLENHHGON��CHK �pONOFSGPOHLRSSGPOPWEN["
SGPOHLRS ["
p AFESp PBSQp PRB1p PRB2p PRB3p PRB4p PRB5p PRB6p PRB7p PRB8p
LNKDpTREN��/_SB_PCI0PEG0LNKS
p
 `�`��/_SB_PCI0PEG0LNKS
[!
dv`��� p\/_SB_PCI0PEG0RTLK[!
dp\/_SB_PCI0PEG0LREN}{ELCT
C {LCTL� LCTLp \/_SB_PCI0PEG0PEGPMLTF�H_ON_��CHK �HGON��GPRFpVGABVREGp
\/_SB_PCI0LPCBEC0_GATY["

�E
HGOF��CHK �p ONOFpLCTLELCTpLNKDp TCNT��CNTLDLY��NKS �"
rTCNT
TCNTpPBSQp
AFESpPRB1pPRB2pPRB3pPRB4pPRB5pPRB6pPRB7pPRB8SGPOHLRSSGPOPWEN ["
2�G_OFF��CHK �p \/_SB_PCI0LPCBEC0_GATY["

��GPRFpVREGVGABHGOF�EPONpONOF� _STA�_DOD �0s�ASGPI �{SGMD
 ��GGPzh
`{h�aGGIVapGGIVab�� �b�b �<SGPO
�{SGMD
 ��GGPzh
`{h�a�� �i�[SGOV SGOVaiECCHK��/_SB_PCI0PEG0PVIDIVID��� ��NOF
������NOF��D#\/_SB_PCI0GFX0M_INI pDID1�LPK pDID2�LPK
 pDID3�LPK
 pDID4�LPK
 pDID5�LPK
 pDID6�LPK

 pDID7�LPK
 pDID2�LPK
 pDID1�LPK
 pDID2�LPK
 pDID3�LPK
 pDID2�LPK
 pDID4�LPK
 pDID2�LPK
 pDID5�LPK
 pDID2�LPK
 pDID6�LPK
 pDID2�LPK
 pDID7�LPK
 LMXMX �� \/_SB_PCI0PEG0PEGPSGPO\/_SB_PCI0PEG0PEGPESEL ������
�\/_SB_PCI0PEG0PEGPSGPI\/_SB_PCI0PEG0PEGPESEL�BMXDS ��
�\/_SB_PCI0PEG0PEGPSGPI\/_SB_PCI0PEG0PEGPDSEL��\/_SB_PCI0PEG0PEGPSGPO\/_SB_PCI0PEG0PEGPDSEL
�TLPK/ �
,�
,�
,�������I>\/_SB_PCI0PEG0PEGPGESC M<GPS__T_1 _T_0 ��i � �E:p�
_T_0��T_0 �
  �8� �T_0
 �
NRIT�
RITS[k

PSTS�
NPSS�
PSESGB32
 �B32 SPLU�B32PSLS�B32
CITS�B32
PSER�RITS�NRITpCITS�p CITSpCITSpPSER�GESCpSPLU�B32�.��T_0
!�/_PR_CPU0_PSS�,��T_0
"� NPPCpNPPC\._PR_CPPC��CNT
�._PR_CPU0
�\._PR_CPU1
�\._PR_CPU2
�\._PR_CPU3
�\._PR_CPU4
�\._PR_CPU5
�\._PR_CPU6
�\._PR_CPU7
�<�CNT
�._PR_CPU0
�\._PR_CPU1
�\._PR_CPU2
�\._PR_CPU3
�"�CNT
�._PR_CPU0
�\._PR_CPU1
��._PR_CPU0
� ���T_0
#�/_PR_CPU0_PPC���T_0
*� QUTP�
GPUT�
	CPUT�

FANS�
SKIN�
CENG�
SEN1�
SEN2GB42
$ �B42 STSV�B42
VERS�B42
TGPU�B42
PDTS�B42
SFAN�B42
SKNT�B42
CPUE�B42
TMP1�B42
 TMP2�p�UTP _T_1��T_1 �CPUTp
 STSV}STSVQUTPSTSVp\/_SB_PCI0LPCBEC0_CPUTPDTS�B42���T_1p
 STSV}STSVQUTPSTSVp�DTS�B42���T_1
}STSVQUTPSTSV�GPUT}STSV STSVp VERSp TGPUp PDTSp SFANp SKNTp CPUEp TMP1p
TMP2�B42�� �� �Jj\/_SB_PCI0GFX0FCSSNR _T_0 �Bp� _T_0��T_0 SBHS
�BHS VERV�BHS
NUMSp  VERVp
NUMS�BHS�=��T_0SCPP
L�CPP VRV1�CPP
VCAP�CPP
VCCP�CPP
VCDP�CPP
VCEP�CPP
VCGP�CPP
VCHP�CPP
VCXP�CPP
 VCYP�CPP
$VCZP�CPP
(VCKP�CPP
,VCMP�CPP
0VCNP�CPP
4VCAL�CPP
8VCBE�CPP
<VCGA�CPP
@VCPP�CPP
DVCDEp 
VRV1p�CAPpXVCCPpXVCDPpXVCEPp�VCGPpVCHPp6VCXPpVCYPp�VCZPpVCKPpVCMPpVCNPpkVCALp<VCBEp
VCGAp VCPPpVCDE�CPP�'��T_0
SGPP
(�GPP VRV2�GPP
VGWP�GPP
VGPP�GPP
VGQP�GPP
VGRP�GPP
VGAP�GPP
VGBP�GPP
VGCP�GPP
 VGDP�GPP
$VGDEp  VRV2p�GWPp�GPPp�GQPp�GRPpVGAPp�GBPpVGCPpVGDPp VGDE�GPP���T_0
SSCP
,�SCP
CSNT�SCP
CPTI�SCP
CICA�SCP
CIRC�SCP
CICV�SCP
CIRA�SCP
CIAV�SCP
 CIEP�SCP
$CPPF�SCP
(CSNRSSGP
,�SGP
GSNT�SGP
GPTI�SGP
GICA�SGP
GIRC�SGP
GICV�SGP
GIRA�SGP
GIAV�SGP
 GIEP�SGP
$GPPF�SGP
(GSNRp �SCP p CSNTpCPTIp
�ICAp CIRCp�CVp
CIRAp �IAVp
CIEPp
CPPFp
CSNRp�SGP p GSNTpGPTIp
�ICAp GIRCp�CVp
GIRAp �IAVp
GIEPp
GPPFp
GSNR�SSCPSSGP � �VSTSTBUD�PSCP M$SPB__T_0 ��i� �K"p� _T_0��T_0 �
  � ��T_0
 pTBUDa{a�a�[\/_SB_PCI0PEG0PEGPPBCM`�\/_SB_PCI0PEG0PEGPPBCM��VSTS }a
 @a����T_0
!�/_PR_CPU0_PSS���T_0
"MCHH � PCAPpPCAPPSCP��PCAP\/_PR_CPU0_PPC��/_PR_CPU0_PPC pMMCHMCHHpMMCH���CAP
pMCHHMMCHpPCAP\._PR_CPPC�._PR_CPU0
�4[\/_PR_CPU1_PPC`pPCAP\/_PR_CPU1_PPC�._PR_CPU1
�4[\/_PR_CPU2_PPC`pPCAP\/_PR_CPU2_PPC�._PR_CPU2
�4[\/_PR_CPU3_PPC`pPCAP\/_PR_CPU3_PPC�._PR_CPU3
�PCAP���T_0
#�SCP���T_0
$[k
THBG[k
DDVE�/_SB_PCI0PEG0PEGPPBCM���T_0
*�SNRk� �D`\/_SB_PCI0PEG0PEGPTGPC
 TDGC DGCX TRPC AGC6Ip \/_SB_PCI0LPCBEC0_GATY["

p\/_SB_PCI0PEG0LREN\/_SB_PCI0PEG0LTREpLNKD��GPI  ["LGC6OSGPO  p
LNKD��NKS
["SGPO  p\/_SB_PCI0PEG0LTRE\/_SB_PCI0PEG0LREN["
p MLTFp
\/_SB_PCI0LPCBEC0_GATY["

GETS��GPI  ���HMOGC6_T_0 ��i  � �EKp� _T_0��T_0 �
 �I��T_0JTB1
 [JTB1 JTEN[JTB1
SREN[JTB1

PLPR[JTB1

FBPR[JTB1

GUPR[JTB1

GC6R[JTB1
PTRH��OSYS�[JTB1
MHYB[JTB1
RPCL[JTB1

GC6V[JTB1

JTRVpJTENpGC6R��OSYS�pMHYBpRPCL��RPCL
pTRPCpGC6VpPTRHpSRENpJTRV�TB1�9��T_0
� �O7��T_0
[k
GUPC[k
PLPC[k
ECOC��OSYS�[k

DFGC[k

GPCXpkTGPC���GUPC ��FGC p�FGC \/_SB_PCI0PEG0PEGPTDGCp�PCX
\/_SB_PCI0PEG0PEGPDGCXJTB3
 [JTB3
GUPS[JTB3
GPGS[JTB3
PLST��OSYS����FGC pGPGSpGUPS�TB3��GUPC GC6IpPLSTp GUPS���GUPC
GC6I��PLPC p PLSTpGPGSp GUPS���GUPC
GC6O���LPC p PLSTpGPGSp GUPS���GUPC
pkTGPCGC6O���LPC p PLST���GUPC pGETSGUPS��GUPS pGPGS�p GPGS�TB3���T_0
� �N��T_0
[k
ATCD[k

ACTD[k
DMSK[k

NCSN[k
NCRT[k
NCSMJTB5
 [JTB5
DPAE[JTB5
LIDE[JTB5
DOCS[JTB5

TLSN[JTB5
DHPS[JTB5

DHPE���CSM p�CSN TLSN���MSK GETD�TCD �CTD p\/_SB_PCI0PEG0PEGPNTOITLSNpDPAE�TB5�
� �T_0
TMP6�
,����DID2�MP6 pDID1�MP6
 pDID4�MP6
 pDID2�MP6
 pDID1�MP6
 pDID2�MP6
	 pDID4�MP6

 pDID1�MP6
 pDID4�MP6
 �MP6� ��\/_SB_PCI0PEG0PEGP\/_SB_PCI0PEG0PEGPGACD \/_SB_PCI0PEG0PEGPGATD
 [�CNV \/_SB_PCI0PEG0PEGPEBAS [�PCNV �  MLTFOMPR
DGOS CTOINTOIMADL MSTE GPRF KrVSTS ��\/_SB_PCI0GFX0CPDL
��/_SB_PCI0GFX0CPDL{DID1�GATD
GATD���/_SB_PCI0GFX0CPDL{DID2�GATDGATD��\/_SB_PCI0GFX0CPL2
��/_SB_PCI0GFX0CPL2{DID1�GATD
GATD���/_SB_PCI0GFX0CPL2{DID2�GATDGATD��\/_SB_PCI0GFX0CPL3
��/_SB_PCI0GFX0CPL3{DID1�GATD
GATD���/_SB_PCI0GFX0CPL3{DID2�GATDGATD��\/_SB_PCI0GFX0CPL4
��/_SB_PCI0GFX0CPL4{DID1�GATD
GATD���/_SB_PCI0GFX0CPL4{DID2�GATDGATD��\/_SB_PCI0GFX0CPL5
��/_SB_PCI0GFX0CPL5{DID1�GATD
GATD���/_SB_PCI0GFX0CPL5{DID2�GATDGATD��\/_SB_PCI0GFX0CPL6
��/_SB_PCI0GFX0CPL6{DID1�GATD
GATD���/_SB_PCI0GFX0CPL6{DID2�GATDGATD��\/_SB_PCI0GFX0CPL7
��/_SB_PCI0GFX0CPL7{DID1�GATD
GATD���/_SB_PCI0GFX0CPL7{DID2�GATDGATD��\/_SB_PCI0GFX0CPL8
��/_SB_PCI0GFX0CPL8{DID1�GATD
GATD���/_SB_PCI0GFX0CPL8{DID2�GATDGATD��\/_SB_PCI0GFX0CADL
��/_SB_PCI0GFX0CADL{DID1�GACD
GACD���/_SB_PCI0GFX0CADL{DID2�GACDGACD��\/_SB_PCI0GFX0CAL2
��/_SB_PCI0GFX0CAL2{DID1�GACD
GACD���/_SB_PCI0GFX0CAL2{DID2�GACDGACD��\/_SB_PCI0GFX0CAL3
��/_SB_PCI0GFX0CAL3{DID1�GACD
GACD���/_SB_PCI0GFX0CAL3{DID2�GACDGACD��\/_SB_PCI0GFX0CAL4
��/_SB_PCI0GFX0CAL4{DID1�GACD
GACD���/_SB_PCI0GFX0CAL4{DID2�GACDGACD��\/_SB_PCI0GFX0CAL5
��/_SB_PCI0GFX0CAL5{DID1�GACD
GACD���/_SB_PCI0GFX0CAL5{DID2�GACDGACD��\/_SB_PCI0GFX0CAL6
��/_SB_PCI0GFX0CAL6{DID1�GACD
GACD���/_SB_PCI0GFX0CAL6{DID2�GACDGACD��\/_SB_PCI0GFX0CAL7
��/_SB_PCI0GFX0CAL7{DID1�GACD
GACD���/_SB_PCI0GFX0CAL7{DID2�GACDGACD��\/_SB_PCI0GFX0CAL8
��/_SB_PCI0GFX0CAL8{DID1�GACD
GACD���/_SB_PCI0GFX0CAL8{DID2�GACDGACDpGATD\/_SB_PCI0PEG0PEGPMADLpGACD\/_SB_PCI0PEG0PEGPMSTEp
GATDp GACDKlGETD
_T_5 _T_4 _T_3 _T_2 _T_1 _T_0
VSTS}\/_SB_PCI0PEG0PEGPMADLh\/_SB_PCI0PEG0PEGPMADL}\/_SB_PCI0PEG0PEGPMSTEi\/_SB_PCI0PEG0PEGPMSTE�cp�/_SB_PCI0PEG0PEGPMADL
_T_0��T_0
�p�/_SB_PCI0PEG0PEGPMSTE _T_1��T_1p\/_SB_PCI0PEG0PEGPCTOIp
\/_SB_PCI0PEG0PEGPNTOI���T_1
p
\/_SB_PCI0PEG0PEGPCTOIp
\/_SB_PCI0PEG0PEGPNTOI���T_1
p
\/_SB_PCI0PEG0PEGPCTOIp
\/_SB_PCI0PEG0PEGPNTOI���T_1
p
\/_SB_PCI0PEG0PEGPCTOIp
\/_SB_PCI0PEG0PEGPNTOI���T_1
p
\/_SB_PCI0PEG0PEGPCTOIp
\/_SB_PCI0PEG0PEGPNTOI���T_1
p
\/_SB_PCI0PEG0PEGPCTOIp\/_SB_PCI0PEG0PEGPNTOI�p\/_SB_PCI0PEG0PEGPCTOIp\/_SB_PCI0PEG0PEGPNTOI�MC��T_0
�p�/_SB_PCI0PEG0PEGPMSTE _T_2��T_2
p
\/_SB_PCI0PEG0PEGPCTOIp
\/_SB_PCI0PEG0PEGPNTOI���T_2
p
\/_SB_PCI0PEG0PEGPCTOIp
\/_SB_PCI0PEG0PEGPNTOI���T_2
p
\/_SB_PCI0PEG0PEGPCTOIp
\/_SB_PCI0PEG0PEGPNTOI�p
\/_SB_PCI0PEG0PEGPCTOIp
\/_SB_PCI0PEG0PEGPNTOI�J1��T_0
�p�/_SB_PCI0PEG0PEGPMSTE _T_3��T_3p\/_SB_PCI0PEG0PEGPCTOIp
\/_SB_PCI0PEG0PEGPNTOI���T_3
p
\/_SB_PCI0PEG0PEGPCTOIp
\/_SB_PCI0PEG0PEGPNTOI���T_3
p
\/_SB_PCI0PEG0PEGPCTOIp\/_SB_PCI0PEG0PEGPNTOI�p\/_SB_PCI0PEG0PEGPCTOIp\/_SB_PCI0PEG0PEGPNTOI�L��T_0
�p�/_SB_PCI0PEG0PEGPMSTE _T_4��T_4p\/_SB_PCI0PEG0PEGPCTOIp
\/_SB_PCI0PEG0PEGPNTOI���T_4
p
\/_SB_PCI0PEG0PEGPCTOIp
\/_SB_PCI0PEG0PEGPNTOI���T_4
p
\/_SB_PCI0PEG0PEGPCTOIp\/_SB_PCI0PEG0PEGPNTOI�p\/_SB_PCI0PEG0PEGPCTOIp\/_SB_PCI0PEG0PEGPNTOI�N�p�/_SB_PCI0PEG0PEGPMSTE
_T_5��T_5p\/_SB_PCI0PEG0PEGPCTOIp\/_SB_PCI0PEG0PEGPNTOI���T_5
p
\/_SB_PCI0PEG0PEGPCTOIp
\/_SB_PCI0PEG0PEGPNTOI���T_5
p
\/_SB_PCI0PEG0PEGPCTOIp
\/_SB_PCI0PEG0PEGPNTOI�F9NVOP_T_0 ��i � �J7p� _T_0��T_0
��\/_SB_PCI0PEG0PEGPDHPS p
a `�p
a `��3��T_0
TMP5
 [TMP5
DAVF[TMP5
LIDF[TMP5

TOGN[k
NCSM[k

NCSN[k
DIMK[k

ACTD[k
ATTD��CSM p�CSN TOGN���IMK GETD�TTD �CTD
p\/_SB_PCI0PEG0PEGPNTOITOGNpDAVF�MP5�&� �T_0
TMP6�
,����DID2�MP6 pDID1�MP6
 pDID4�MP6
 pDID2�MP6
 pDID1�MP6
 pDID2�MP6
	 pDID4�MP6

 pDID1�MP6
 pDID4�MP6
 �MP6���T_0
�/_SB_PCI0PEG0PEGPGOBTk���T_0
[k

OPCE[k FLCH[kDVSR[k
DVSC��LCH p�PCE OMPRRBUF
 [RBUF OPEN[RBUF

CGCS[RBUF
SHPC[RBUF
SNSR[RBUF

DGPC[RBUF

HDACpOPEN��\/_SB_PCI0PEG0PEGPDHPS pSHPCpHDAC��\/_SB_PCI0PEG0PEGPDPCS
pDGPC��VSC ��VSR pGPRF�p GPRFpGPRFSNSR�\/_SB_PCI0PEG0PEGPGSTAp
CGCS�p CGCS�p
CGCS�BUF���T_0
pk`[` OPFL[`OPVL��PVL p OPTF��PFL pOPTFpOPTF`��� �LGOBTOPVKF
� �
USRG��SRGKV�PVK�GSTA��GPIPWOK���J_PS0 �DGOS��\/_SB_PCI0PEG0PEGPDPCS
\/_SB_PCI0PEG0PEGP_ON_p DGOS��\/_SB_PCI0PEG0PEGPDHPS p MLTFH_PS3
��/_SB_PCI0PEG0PEGPOMPR
��\/_SB_PCI0PEG0PEGPDPCS \/_SB_PCI0PEG0PEGP_OFFpDGOSp
\/_SB_PCI0PEG0PEGPOMPRC_ROM
_T_0 ph`piaVROMa �� p a��RVBS�ROMrhib��RVBStRVBS`ax` �d�pd_T_0��T_0
p\/_SB_PCI0PEG0PEGPVBS1e���T_0p\/_SB_PCI0PEG0PEGPVBS2e���T_0
p\/_SB_PCI0PEG0PEGPVBS3e���T_0
p\/_SB_PCI0PEG0PEGPVBS4e� ��T_0
p\/_SB_PCI0PEG0PEGPVBS5e���T_0
p\/_SB_PCI0PEG0PEGPVBS6e���T_0
p\/_SB_PCI0PEG0PEGPVBS7e���T_0
p\/_SB_PCI0PEG0PEGPVBS8e� �dt`d`�`aVROM�ROMMMXMX ��
\/_SB_PCI0PEG0PEGPSGPOESELP8XH
�8XH ���P8XH
�8XH ���
P8XH
�8XH
�/_SB_PCI0PEG0PEGPSGPIESEL�KMXDS ��
�/_SB_PCI0PEG0PEGPSGPIDSEL��\/_SB_PCI0PEG0PEGPSGPODSEL�M_DSM_T_0 ��
Q��$I�� �4��\/_SB_PCI0PEG0PEGPGC6S �/_SB_PCI0PEG0PEGPOGC6hijk��
�
�B�p����\/_SB_PCI0PEG0PEGPVENS �/_SB_PCI0GFX0SPB_hijk��
-��I��F��7�\/_SB_PCI0PEG0PEGPGPSS �/_SB_PCI0PEG0PEGPGPS_hijk��
��G�`B���/_SB_PCI0PEG0PEGPNVOPhijk��
 �@}�L�y��e�p� _T_0��T_0 �
 ���T_0
�
0 ���T_0
�� ��MXBS MXM3MXBS pMXMBMXM3�XM3� � �MAR� �ENOVOCB-01  ACPI  &  �
   �  �   �u �    z �   FPDTD �ENOVOCB-01  ACPI   �   �
BGRT8 LENOVOCB-01  ACPI   �f @ � XSDT� 
LENOVOCB-01    � �w �w �w P� @� 0� � � � � �w �w �w �w �w �w �w �w 0� � � �

Sun Oct 17 13:06:32 EDT 2021
foo


Sat Oct 16 10:08:02 EDT 2021
from typing import Tuple, List, Iterator, TextIO, Dict, Callable
from typing_extensions import Protocol


Coords = Tuple[int, int]

Field = List[List['Cell']]

Context = Field


def directions() -> Iterator[Coords]:
	for i in range(-1, 2):
		for j in range(-1, 2):
			if (i, j) != (0, 0):
				yield i, j


def show_cells(cells: Field) -> str:
	return "\n".join(map(lambda row: "".join(
		map(lambda c: str(c), row)), cells))


# reject inheritance, embrace composition
class Cell(Protocol):
	def update(self, ctx: Field) -> 'Cell':
		...


def count_alive(ctx: Field) -> int:
	n = 0
	for y in range(len(ctx)):
		for x in range(len(ctx[y])):
			if (y, x) != (1, 1) and not isinstance(ctx[y][x],
			DeadCell):
				n += 1
	return n


class DeadCell:
	def update(self, ctx: Field) -> Cell:
		if count_alive(ctx) == 3:
			return AliveCell()
		else:
			return self

	def __str__(self) -> str:
		return "-"


class AliveCell:
	def update(self, ctx: Field) -> Cell:
		if count_alive(ctx) in [2, 3]:
			return self
		else:
			return DeadCell()

	def __str__(self) -> str:
		return "o"


Registry = Dict[str, Callable[[], Cell]]
# help MyPy figure out what we want
rl: List[Callable[[], Cell]] = [DeadCell, AliveCell]
registry: Registry = {t.__name__: t for t in rl}
del rl


def in_bounds(p: Coords, b: Coords) -> bool:
	return 0 <= p[0] and p[0] < b[0] and 0 <= p[1] and p[1] < b[1]


def make_world(size: int) -> Field:
	return [[DeadCell() for x in range(size)] for y in range(size)]


class World:
	size: int
	cells: List[List[Cell]]

	def __init__(self, size: int) -> None:
		self.size = size
		self.cells = make_world(size)

	def update(self) -> None:
		# this line had me stumped for hours :)
		# i switched from dict to list, but forgot to change cells.copy()
		to a 2-deep copy
		# the Rust people were right, mutable aliasing is the root of all
		evil
		# i miss Haskell
		new_cells = [row.copy() for row in self.cells]
		for y in range(self.size):
			for x in range(self.size):
				ctx = make_world(3)
				ctx[1][1] = self.cells[y][x]
				for dy, dx in directions():
					p = (y + dy, x + dx)
					if in_bounds(p, (self.size, self.size)):
						ctx[1 + dy][1 + dx] =
						self.cells[p[0]][p[1]]
				new_cells[y][x] = self.cells[y][x].update(ctx)
		self.cells = new_cells

	def __str__(self) -> str:
		return show_cells(self.cells)

	def dump(self, f: TextIO) -> None:
		# format version
		print(0, file=f)
		print(self.size, file=f)
		for row in self.cells:
			print(",".join([type(cell).__name__ for cell in row]),
			file=f)

	@staticmethod
	def load(f: TextIO, registry: Registry = registry) -> 'World':
		v = int(f.readline())
		if v != 0:
			raise Exception("wrong format version")
		size = int(f.readline())
		w = World(size)
		for y, line in enumerate(f):
			for x, cell in enumerate(line.strip().split(",")):
				w.cells[y][x] = registry[cell]()
		return w


#if __name__ == '__main__':
world = World(30)
# create a glider
for y, x in [(0, 1), (2, 0), (2, 1), (2, 2), (1, 2)]:
	world.cells[y][x] = AliveCell()
for _ in range(100):
	print(world)
	world.update()


Fri Oct 15 15:48:59 EDT 2021
12:20 < joe9> BurnZeZ: do you recall how you found out about replica(8).  It
is cool.  I cannot believe that it is not more popular
12:22 < joe9> anyone has the man books?  9FRONT PROGRAMMER'S MANUAL V2 and
V1. I am about to order them, but, want to check if anyone has them and find them
useful.
12:24 < mycroftiv> joe9: old plan 9 from bell labs used replica/pull as the
mechanism to update the distribution
12:25 -!- Irssi: mycroftiv myrkul
12:25 < kvik> khm: ok, good to know.  my domain and patience with gandi
webshit is about to expire, so i'm looking around
12:25 < joe9> mycroftiv: do you use it?  any practical experiences to share?
12:25 < joe9> kvik: namesilo?
12:25 < aiju> we specifically dropped replica because it sucked
12:25 < mycroftiv> joe9: i like burnzez rewrite of the support scripts to
'rep'
12:25 < aiju> i think it was very slow
12:25 < aiju> but i forgot what other objections there were
12:26 < aiju> obviously centralised
12:26 < mycroftiv> the value of replica(8) as a tool is independent of
whether or not it was well used and administered by labs for distro updates
12:27 < mycroftiv> the replica(1) scripts and config are rather
over-elaborate which is why i think it hasnt been used very much by people for
personal file tree synchronization
12:27 < kvik> my main objection is it's grossly overcomplicated to setup for
what you end up with
12:28 < mycroftiv> thats why i like burnzez rep stuff, but since it is
undocumented and exists only in burnzez griddisk, it hasnt taken over the world
yet
12:28 < joe9> I have data on a hosted vm, my local machine, backup of the
local machine.  I used fcp -x and disk/mkfs to synchronise them.  but, disk/mkfs
only uses modification time.  Hence, I had to have a wrapper to ensure that I am
not missing stuff.
12:28 < kvik> i should really implement proper sync for clone.  but i've
been saying that since the winter
12:28 < joe9> when reading about replica, it seems to do exactly that.
12:29 < joe9> but, I am not sure how it is regarded in practice.
12:29 < mycroftiv> yes syncing files between systems is exactly what replica
is intended for
12:29 < kvik> yea, it also just compares timestamp iirc
12:29 < joe9> kvik: replica(8) says that it uses modtime and size.
12:30 < kvik> i guess there's just a lot more buttons to press as opposed to
bare mkfs
12:30 < mycroftiv> its little used in practice because setting up the config
files is one of those things where everyone reads the manapge and says 'uck, maybe
ill deal with this some other time'
12:30 < joe9> mycroftiv: do you know where burnzez's scripts are?
replica(1)?
12:30 < mycroftiv> joe9: they are in burnzez griddisk directory on the
public grid
12:30 < mycroftiv> ive been trying to get him to document them for weeks but
burnzez doesnt work to order
12:31 < joe9> that makes sense.  I read the man page and realized that I
need a print edition and understand them before I can do much.
12:32 < joe9> mycroftiv: do you know if burnzez has any plans to merge his
scripts into 9front?  or, does he want to leave them as they are.
12:40 < aiju> hm
12:40 < BurnZeZ> I do not because replica sucks
12:41 < aiju> yeah, i think the knowledge of knowledge ofknowledge of ...
thing is spot on
12:44 < joe9> BurnZeZ: if you have a few free minutes, what do you not like
about replica?  speed?  or hard to configure?
12:45 < joe9> I have a high latency link to my hosted vm.  I use fcp -x to
transfer files.
12:45 < BurnZeZ> While speed is not terrible, it's not great
12:45 < BurnZeZ> Configuration difficulty is one factor
12:45 < joe9> I want to replace it with replica(?)
12:45 < BurnZeZ> The other part is that replica seems to be designed with a
parent-child dichotomy
12:45 < BurnZeZ> client-server
12:45 < BurnZeZ> But it doesn't make much sense to do so
12:46 < BurnZeZ> Really it should be bidirectional, and it has a bunch of
nonsense to do just that
12:46 < joe9> my use case is that I always get stuff from the hosted vm.
so, the client-server is fine here.
12:46 < joe9> and I am always sending stuff to the backup.
12:46 < BurnZeZ> If you do have synchronization needs, it works okay
12:47 < joe9> so, I have no need for bidirectional stuff.
12:47 < BurnZeZ> It breaks with append-only files
12:47 < joe9> oh, ok.  I am not using append-only files.
12:47 < joe9> I had issues with append-only files too.
12:48 < joe9> even fcp or cp (I cannot recall) messed such files up.

burnzez.  do you know if the rep stuff is hosted somewhere else other than on
griddisk?
joe9 : burnzez.  do you know if the rep stuff is hosted somewhere else other than
on griddisk?
BurnZeZ : Probably not
I am not sure what the purpose of the log file is.  in
/n/griddisk/burnzez/rep/rep.  But, it lists some files which are not in
root/rc/bin/rep
joe9 : I am not sure what the purpose of the log file is.  in
/n/griddisk/burnzez/rep/rep.  But, it lists some files which are not in
root/rc/bin/rep
kvik : wewantrepdocs.com is free
stillneedrepdocs : i had a few burnzez lines saved at one point i copy/pasted to
explain things so i could probably grep the logs for them
stillneedrepdocs : rep grep
BurnZeZ : nuts
BurnZeZ : I was going to write docs then got super demotivated because I realized
replica’s problems
are there any other problems?
joe9 : are there any other problems?
stillneedrepdocs : moody : BurnZeZ: do you have a quick reference for rep ?
stillneedrepdocs : mycroftiv : BurnZeZ : mkdir /rc/bin/rep; cp
/n/griddisk/burnzez/rep/rep/root/rc/bin/rep/* /rc/bin/rep/
stillneedrepdocs : mycroftiv : BurnZeZ : mkdir /usr/$user/lib/rep
stillneedrepdocs : mycroftiv : BurnZeZ : rep/cinit
/n/griddisk/burnzez/rep/libautism/ libautism
stillneedrepdocs : mycroftiv : BurnZeZ : This line creates the directory
/usr/$user/lib/rep/libautism
stillneedrepdocs : mycroftiv : BurnZeZ : rep/pull libautism
BurnZeZ : I don’t recall any at the moment
mycroftiv : if i recall, you probably also want to rep/cinit for rep itself too

10:33 < joe9> BurnZeZ: I am familiarising myself with replica code.  I have
to profile it and figure out why it is slow.  From a cursory reading, I would
assume it is due to finddb(?).
10:33 < BurnZeZ> Hmm
10:34 < BurnZeZ> Replica shouldn't be slow
10:34 < joe9> on a local machine, I can see it going through each file.
10:34 < BurnZeZ> Ah
10:34 < joe9> replca/applylog is what is being run when I do replica/pull
-nv
10:34 < BurnZeZ> You're using the replica scripts
10:34 < joe9> this is for the first time that replica runs.
10:34 < joe9> yes, I am using replica's scripts
10:35 < BurnZeZ> I wrote rep because I felt the original scripts were too
complicated
10:35 < joe9> not yours yet.  I am want to understand what was before before
I can figure out your changes.
10:35 < joe9> oh, ok.
10:35 < BurnZeZ> It's probably worth learning replica(8) instead of the
scripts
10:35 < BurnZeZ> Err
10:35 < joe9> rep is a replacement of replica(1)?
10:35 < BurnZeZ> Yeah, replica(8)
10:35 < BurnZeZ> joe9: Basically
10:36 < BurnZeZ> There is two things
10:36 < BurnZeZ> replica, and replica rc scripts
10:36 < joe9> but, it is not replica(1) that is the issue.  I can see the
replica/applylog going through each file.
10:36 < BurnZeZ> Yeah
10:36 < joe9> replica/applylog belongs to replica(8)
10:37 < BurnZeZ> Another bad thing
10:37 < joe9> to understand, rep is a wrapper around replica(8), correct?
10:37 < BurnZeZ> replica(8) is not fully documented
10:37 < BurnZeZ> There is undocumented parameters that are important
10:37 < joe9> the code looks in cinap's style.  Did cinap write
replica/applylog?
10:38 < BurnZeZ> It's bell labs stuff I think
10:38 < joe9> 10:37 < joe9> to understand, rep is a wrapper around
replica(8), correct?
10:38 < joe9> would you mind answering it, please?
10:38 < BurnZeZ> joe9: One thing replica/applylog does that sucks
10:39 < BurnZeZ> Yes, rep is scripts that wraps replica(8)
10:39 < BurnZeZ> it spools files to /tmp/ first
10:39 < BurnZeZ> Which slows everything down
10:39 < Aram> aiju: ugh, I didn't know such things existed at all:
https://mathoverflow.net/questions/43462/existence-of-a-smooth-function-with-nowhere-converging-taylor-series-at-every-po
10:40 < BurnZeZ> joe9: It may be worth updating replica(8) so that the
manpage and code are synchronized
10:40 < joe9> it spools files to /tmp/ first - thanks, I see the big files
in /tmp/.  I cannot figure out what they are though.
10:40 < joe9> replica09550629 is the filename
10:40 < BurnZeZ> Yeah
10:40 < BurnZeZ> It's really stupid
10:40 < Aram> in fact
10:40 < Aram> https://en.wikipedia.org/wiki/Non-analytic_smooth_function
10:40 < BurnZeZ> I mean, I understand why it is done
10:41 < BurnZeZ> And it has a good reason
10:41 < BurnZeZ> But not good enough
10:41 < joe9> which file is it?  Is it the original file from the server?
10:41 < BurnZeZ> Yes
10:41 < joe9> s/which/what/
10:41 < BurnZeZ> It copies the server file to /tmp/ before replacing the
client file with it
10:41 < joe9> oh, really.  over a low latency link, that would be a killer
10:42 < joe9> even if the files are the same?
10:42 < BurnZeZ> No
10:42 < BurnZeZ> However
10:42 < BurnZeZ> It does not do delta synchronization
10:42 < joe9> I understand and do not want delta sync
10:42 < BurnZeZ> Just making sure that's clear
10:43 < BurnZeZ> If the server file is modified, the whole file must be
copied
10:43 < BurnZeZ> And it copies to /tmp/ first
10:43 < BurnZeZ> I think the idea is so you can be sure you could actually
GET the entire file
10:43 < BurnZeZ> Before you replace the client file with it
10:43 < BurnZeZ> Instead of start replacing the file and then some read
error
10:44 < joe9> yes, that makes sense.
10:44 < joe9> In my case, this is the first time I am running replica and it
should not be doing it when the files are the same.
10:44 < joe9> let me reset the client db and log and try.
10:44 < BurnZeZ> Hmm
10:44 < BurnZeZ> Yeah, it sounds like the database is not right
10:44 < BurnZeZ> That's part of why I wrote rep
10:44 < BurnZeZ> But after I wrote it, now I hate replica :)
10:45 < BurnZeZ> The best thing would be to use venti for all this
10:45 < BurnZeZ> Then we would even have delta synchronization
10:45 < BurnZeZ> For free
10:45 < BurnZeZ> venti concept, I mean
10:46 < BurnZeZ> Not the implementation that exists
10:46 < joe9> another thing that I cannot understand, When I start from
scratch, no db or log file, I get this error
10:46 < joe9> replica/compactdb: opendb /dist/replica/client/ddfbkp.db:
'/dist/replica/client/ddfbkp.db' does not exist
10:47 < joe9> this is probably replica(1) in play(?)
10:47 < BurnZeZ> touch the file first
10:47 < BurnZeZ> I don't think the scripts will create it
10:47 < BurnZeZ> I could be wrong
10:48 < joe9> yes, it works then.  But, in that scenario, it skips the
!havedb if statement in applylog
10:48 < joe9> I am wrong.
10:48 < BurnZeZ> Ah, right
10:48 < BurnZeZ> Oh
10:48 < joe9> sorry, my mistake, I think.
10:48 < BurnZeZ> Yeah, the scripts are confusing
10:48 < BurnZeZ> I recommend ignoring them and using replica(8) directly
10:49 < joe9> ok, thanks.  will think this through.
10:49 < BurnZeZ> 9fs 9contrib && replica/updatedb -r /n/9contrib/contrib
$home/lib/replica/contrib/sdb >> $home/lib/replica/contrib/log
10:49 < BurnZeZ> 9fs 9contrib && replica/applylog
$home/lib/replica/contrib/cdb /tmp/contrib/ /n/9contrib/contrib <
$home/lib/replica/contrib/log
10:49 < BurnZeZ> A couple old snippets
10:49 < yuuko> https://kurofuku.me/i/1559843282.png
10:49 < joe9> yes, please, these will help me a lot.
10:49 < BurnZeZ> This doesn't use replica(1)
10:49 < BurnZeZ> Even though it uses the same directory paths
10:50 < BurnZeZ> I think
10:51 < joe9> ok, thanks.
10:51 < BurnZeZ> I really dislike the replica scripts
10:51 < BurnZeZ> They are just way too complicated
10:52 < BurnZeZ> If it was up to me, I would get rid of them entirely
10:52 < joe9> ok, thanks.  I will read up on your scripts now that I have a
clue.
10:52 < BurnZeZ> All they do is confuse people who want to use replica
10:54 < BurnZeZ> ftpfs -a my@mail goes.gsfc.nasa.gov && replica/updatedb -r
/n/ftp/pub/goescolor/goeseast/hurricane2/color_lrg -x older_images
/tmp/replica/goes.gsfc.nasa.gov/sdb >> /tmp/replica/goes.gsfc.nasa.gov/log
10:54 < BurnZeZ> ftpfs -a my@mail goes.gsfc.nasa.gov && replica/applylog
/tmp/replica/goes.gsfc.nasa.gov/cdb (/tmp/ftp/goes.gsfc.nasa.gov
/n/ftp)^/pub/goescolor/goeseast/hurricane2/color_lrg/ <
/tmp/replica/goes.gsfc.nasa.gov/log
10:54 < BurnZeZ> I doubt these will be valid anymore
10:54 < BurnZeZ> But it's another interesting usage
11:03 < joe9> to first seed the client db, is there a replica/scan on the
client?
11:03 < joe9> s/is there a/is there a way to do/
11:04 < BurnZeZ> You can run updatedb on the client root, and create the
client database
11:04 < joe9> ok, that should help me.  Thanks.
11:05 < BurnZeZ> But I'm not sure if this will confuse replica in some way
11:05 < BurnZeZ> Ideally it should work
11:05 < joe9> ok, thanks.  I should focus on replica(8) then.  Thanks.
11:33 < joe9> BurnZeZ: do you recall what this does?  clientdb clientroot
serverroot [ path ...  ]
11:33 < joe9> it is documented twice in replica(8) too.
11:33 < joe9> I mean the command.
11:33 < BurnZeZ> It's the other commands being wrapped
11:34 < BurnZeZ> man -P 8 replica
12:33 < mischief> joe9: have you used kvik's clone
12:47 < joe9> mischief: I think I checked it out.  but, have not tried it.
Would you recommend it over replica(8)?
12:51 < mischief> joe9: i'm not very familiar with how replica works, but
clone can avoid most of the latency penalty when copying multiple files over 9p
12:55 < joe9> mischief: ok, thanks.  will check it out.
12:56 < joe9> I vaguely recall that it was similar to cp -x though.
13:00 < mischief> joe9: clone uses a process pool to do things in parallel..
cp is serial
13:00 < mischief> time a copy of a file tree off a remote 9p server with
dircp or cp and then do it with clone
13:55 < joe9> BurnZeZ: regarding the replica log files, any suggestions on
when to purge them?  after each transfer?
13:57 < BurnZeZ> The log is used to determine what files to update
13:58 < BurnZeZ> I guess maybe it can be deleted
13:59 < BurnZeZ> But I'm not entirely sure
14:04 < joe9> ok, thanks.

Burnzez, I am trying out a little hack.  Before doing applylog, I have an awk
script do fcp -x of any big files.
joe9 : Burnzez, I am trying out a little hack.  Before doing applylog, I have an
awk script do fcp -x of any big files.
BurnZeZ : Same with awk
that should give better throughput than plain old applylog
joe9 : that should give better throughput than plain old applylog
BurnZeZ : replica uses fcp
half: BurnZeZ: Aye.
oh, it does.  I thought it did not.  I did not see any worker threads.  I have to
doublecheck though.
joe9 : oh, it does.  I thought it did not.  I did not see any worker threads.  I
have to doublecheck though.
BurnZeZ : Oh wait no
BurnZeZ : The replica scripts do
BurnZeZ : And it’s only for copying $serverlog to $clientlog
oh, actually I take that back.
joe9 : oh, actually I take that back.
copy1 of applylog has threads
joe9 : copy1 of applylog has threads
I mean it has different workers
joe9 : I mean it has different workers
BurnZeZ : Right
oh, so, it should be fine then.  sorry for the bother.
joe9 : oh, so, it should be fine then.  sorry for the bother.
BurnZeZ : Yeah, this stuff isn’t documented in the manpage
BurnZeZ : I don’t know why they bothered writing the scripts instead of making the
manpage more clear


Thu Oct 14 19:11:08 EDT 2021

     ACMED(8) ACMED(8)

     NAME
	  ip/acmed - acme certificate client

     SYNOPSIS
	  ip/acmed [ -a acctkey ] [ -o chalout ] [ -p provider ] [ -t
	  type ] acctname csr [ domain ]

     DESCRIPTION
	  Acmed fetches and renews TLS certificates using the acme
	  (RFC8555) protocol.  It requires a pregenerated account key
	  and certificate signing key.

	  Acmed accepts the following options:

	  -a acctkey Specifies that acctkey is used to sign requests
	       to the provider in place of the default
	       /sys/lib/tls/acme/$acctname.pub.  The key must be a jwk
	       formatted RSA key.

	  -o chalout specifies that the challenge material is placed
	       in the location chalout.

	       For HTTP challenges, chalout must be a directory that
	       your choice of httpd will serve at
	       http://domain.com/.well-known/acme-challenge.  For DNS
	       challenges, chalout is a file that should be included
	       in your ndb database.

	       If unspecified, http challenges will output to
	       /usr/web/.well-known/acme-challenge, whle dns chal-
	       lenges will output to /lib/ndb/dnschallenge.

	  -p provider Specifies that provider is used as the pro-
	       vider URL, in place of the default https://acme-
	       v02.api.letsencrypt.org/directory.  This must be the
	       directory URL for the desired RFC8555 compliant pro-
	       vider

	  -t type Specifies that the challenge type.  Supported chal-
	       lenge types are currently http and dns.

     EXAMPLES
	  Before acmed is run, the keys must be generated.

	       auth/rsagen -t 'service=acme role=sign hash=sha256 acct=a@b.org'\
		    >acct.key
	       auth/rsa2jwk acct.key >/sys/lib/tls/acmed/me@example.org.pub
	       auth/rsagen -t 'service=tls owner=*' >cert.key
	       auth/rsa2csr 'CN=mydomain.com' cert.key \
		    >/sys/lib/tls/acmed/mydomain.com.csr} \

	  This need only be run once.

	  The certificate for the domain can now be fetched:

	       acmed me@example.org /sys/lib/tls/acmed/mydomain.com.csr \
		    >/sys/lib/tls/acmed/mydomain.com.crt

	  When using a DNS challenge, your DNS server must be config-
	  ured, and must be configured to include the DNS challenge
	  file:

	       database=
		    file=/net/ndb
		    file=/lib/ndb/local
		    file=/lib/ndb/common
		    file=/lib/ndb/dnschallenge

	       And acmed must be invoked with the domain:

	       acmed me@example.org \
		    /sys/lib/tls/acmed/mydomain.com.csr \
		    mydomain.com \
		    >/sys/lib/tls/acmed/mydomain.com.crt

     SEE ALSO
	  rsa(8), srvtls(4).

     SOURCE
	  /sys/src/cmd/ip/acmed.c

     HISTORY
	  Ip/acmed first appeared in 9front (Oct 2021)



Thu Oct 14 13:14:41 EDT 2021
After “Magnum P.I.’s” run in the 1980s, Selleck himself even discussed the
possibility of a movie sequel written by “The Hunt for Red October” scribe Tom
Clancy (who, according to Selleck, was a fan of the series).

Thu Oct 14 11:21:23 EDT 2021
---
/usr/binarycat/src/castor9/.git/fs/object/0fcf30342402aff054a8106bb08a30f670ad62c0/tree/castor.c
+++ castor.c
@@ -47,6 +47,7 @@
 void addbookmark(void);
 void showbookmarks(void);
 void message(char *s, ...);
+void visit(Url *url);

 Panel *root;
 Panel *backp;
@@ -58,6 +59,8 @@
 Mouse *mouse;
 Hist *hist = nil;
 int preformatted = 0;
+char *bookmarkspath;
+Url *filebase;

 enum
 {
@@ -354,10 +357,38 @@
 }

 void
+geminishow(Ctx *c, Biobuf *body)
+{
+ char *line;
+ Hist *h;
+
+ h = malloc(sizeof *h);
+ if(h == nil)
+ sysfatal("malloc: %r");
+
+ while((line = Brdstr(body, '\n', 0)) != nil){
+ if(strbeg(line, "=>") == 0){
+ renderlink(c, line);
+ }else{
+ rendertext(c, line);
+ }
+ free(line);
+ }
+
+ Bflush(body);
+
+ h->p = hist;
+ h->n = nil;
+ h->c = c;
+ hist = h;
+
+ show(c);
+}
+
+void
 geminiget(Url *url)
 {
	int fd;
- char *line;
	Biobuf body;

	Ctx *c;
@@ -372,11 +403,6 @@
		sysfatal("malloc: %r");
	r->url = url;

- Hist *h;
- h = malloc(sizeof *h);
- if(h == nil)
- sysfatal("malloc: %r");
-
	plrtstr(&c->text, 1000000, 0, 0, font, strdup(" "), 0, 0);

	message("loading %s...", urlstr(url));
@@ -405,23 +431,7 @@
			page(url);
			resettitle();
		}else{
- while((line = Brdstr(&body, '\n', 0)) != nil){
- if(strbeg(line, "=>") == 0){
- renderlink(c, line);
- }else{
- rendertext(c, line);
- }
- free(line);
- }
-
- Bflush(&body);
-
- h->p = hist;
- h->n = nil;
- h->c = c;
- hist = h;
-
- show(c);
+ geminishow(c, &body);
		}
		break;
	case 30:
@@ -607,8 +617,12 @@
 createbookmarks(void)
 {
	int fd;
- if((fd = create(getbookmarkspath(), OWRITE, 0600 | DMAPPEND)) < 0)
- sysfatal("create(bookmarks): %r");
+
+ if((fd = open(bookmarkspath, OWRITE)) < 0)
+ sysfatal("open(bookmarks): %r");
+ if(seek(fd, 0, 2)<0)
+ sysfatal("seek(bookmarks): %r");
+
	return fd;
 }

@@ -615,44 +629,7 @@
 void
 showbookmarks(void)
 {
- char *line;
- Biobuf *bfile;
-
- bfile = Bopen(getbookmarkspath(), OREAD);
- if(bfile==nil){
- message("You must bookmark a page first!");
- return;
- }
-
- Ctx *c;
- c = malloc(sizeof *c);
- if(c==nil)
- sysfatal("malloc: %r");
- c->text = nil;
- c->url = urlparse(nil, "file://bookmarks");
-
- Hist *h;
- h = malloc(sizeof *h);
- if(h == nil)
- sysfatal("malloc: %r");
-
- plrtstr(&c->text, 1000000, 0, 0, font, strdup(" "), 0, 0);
-
- message("loading bookmarks...");
-
- while((line = Brdstr(bfile, '\n', 0)) != nil){
- renderlink(c, line);
- free(line);
- }
-
- Bflush(bfile);
-
- h->p = hist;
- h->n = nil;
- h->c = c;
- hist = h;
-
- show(c);
+ visit(urlparse(filebase, bookmarkspath));
 }

 void
@@ -672,10 +649,10 @@
	if(strlen(t) == 0)
		return;

- if(strbeg(t, "gemini://") != 0)
+ if(strchr(t, ':') == 0)
		t = smprint("gemini://%s", t);

- geminiget(urlparse(nil, t));
+ visit(urlparse(currentbaseurl(), t));
 }

 void
@@ -713,12 +690,8 @@
		}
		next_url = urlparse(nil, n);
	}
-
- if(strcmp(next_url->scheme, "gemini") == 0){
- geminiget(next_url);
- }else{
- plumburl(next_url);
- }
+
+ visit(next_url);
 }

 void
@@ -797,6 +770,30 @@
 }

 void
+visit(Url *url)
+{
+ if(strcmp(url->scheme, "gemini") == 0){
+ geminiget(url);
+ }else if(strcmp(url->scheme, "file") == 0){
+ Ctx *c;
+ Biobuf* b;
+
+ c = malloc(sizeof *c);
+ if(c == nil)
+ sysfatal("malloc: %r");
+ c->text = nil;
+ c->url = url;
+ plrtstr(&c->text, 1000000, 0, 0, font, strdup(" "), 0, 0);
+ b = Bopen(url->path, OREAD);
+ if(b == nil)
+ sysfatal("open: %r");
+ geminishow(c, b);
+ }else{
+ plumburl(url);
+ }
+}
+
+void
 main(int argc, char *argv[])
 {
	Event e;
@@ -803,15 +800,19 @@
	Url *url;
	enum { Eplumb = 128 };
	Plumbmsg *pm;
- if(argc == 2)
- if(strbeg(argv[1], "gemini://") != 0){
+ char buf[256];
+
+ filebase = urlparse(nil, smprint("file://%s/%s/", getenv("sysname"),getwd(buf,
sizeof buf)));
+ argv0 = argv[0];
+ if(argc == 2){
+ if(strchr(argv[1], ':') || access(argv[1], AEXIST) == 0)
+ url = urlparse(filebase, argv[1]);
+ else
			url = urlparse(nil, smprint("gemini://%s", argv[1]));
- }else{
- url = urlparse(nil, argv[1]);
- }
- else
+ }else
		url = urlparse(nil, "gemini://gemini.circumlunar.space/capcom/");
-
+ if(url == nil)
+ sysfatal("bad url");
	quotefmtinstall();
	fmtinstall('U', Ufmt);
	fmtinstall('N', Nfmt);
@@ -819,6 +820,7 @@
	fmtinstall('E', Efmt);
	fmtinstall('[', encodefmt);
	fmtinstall('H', encodefmt);
+ bookmarkspath = getbookmarkspath();

	if(initdraw(nil, nil, "gemini")<0)
		sysfatal("initdraw: %r");
@@ -825,7 +827,7 @@
	einit(Emouse|Ekeyboard);
	plinit(screen->depth);
	mkpanels();
- geminiget(url);
+ visit(url);
	eresized(0);
	eplumb(Eplumb, "gemini");
	for(;;){
@@ -833,7 +835,7 @@
		case Eplumb:
			pm = e.v;
			if(pm->ndata > 0){
- geminiget(urlparse(nil, pm->data));
+ visit(urlparse(nil, pm->data));
			}
			plumbfree(pm);
			break;


Wed Oct 13 23:32:00 EDT 2021
Hello,

I like you very much.  Nice to meet u!

Bye


Tue Oct 12 21:12:35 EDT 2021
From googlegroups.com!golang-dev+bncBCXNNIE25YEBBMGKTCFQMGQEOQV5AFQ Tue Oct 12
20:15:53 -0400 2021
ARC-Seal: i=2; a=rsa-sha256; t=1634084145; cv=pass;
	d=google.com; s=arc-20160816;
	b=RAcPIGNz1w3WWaJaCLjDaGZyhbUeNN34SZbStqT1VwOVNG3x9cDPbsCfiCPqw7ujVl
	 B9I6+MjvMzpWuLoN7CCYMAs7Ku+Gl8UAiu9AUUg1dEalINRynQvegsVMZeQqYdMgA3kc
	 CT+n2TdSvk5aKtjPLCGEH0axgTmK+Tt0SgX8hyMMWVgr0XTy+s9wJ7lZcn/Nez8hVzHl
	 k9L9L5+QoSmNomdgbJY+sc/QufehlxQocO0chc4coS6pmck/6H98VAeBIWIT4EXlBkMU
	 TQgJw0p5gzxnEyimSDiQwHdXTG0m4MmT99IJjpX2alWp+Ki58MnSzTtWBV2xhYGj1c8a
	 UPtQ==
ARC-Message-Signature: i=2; a=rsa-sha256; c=relaxed/relaxed; d=google.com;
s=arc-20160816;
	h=list-unsubscribe:list-subscribe:list-archive:list-help:list-post
	 :list-id:mailing-list:precedence:to:subject:message-id:date:from
	 :mime-version:sender:dkim-signature;
	bh=xue5bTnGN3FYph2bbdSIuU8qqH2T7LG2OyGYsZ9c528=;
	b=h3Rjl1BvXu+e+bHzqDI/pbm8g0X+wqRGC0+iw2lSAAkkxsoSs7KDD9e7mJeuvY4FcU
	 Od2ZdIghLL4sCylZjuyHjrqjanDUw7MuIfVFUMHw4Q2vn4zBSMzPI3yFH2wDcSAiQsfb
	 RvYY4FMQhI5uEOnltJi+48swRhupve/8unFwMM7t0p6cPmIpFVM/smkuKCs+aPWo2hQN
	 vNn0zKTzCd8nclabRNB68U/n9ltN22RU/HIjGIOBvyNzNOAqwcKV1GXInQBHA/aVICG/
	 24HAApxVQLIOHXkbVPyHlJsfrdpK+xqbB+CCfx3WNHSI9ZW6Yimaiyldff9IQy6uEMQH
	 E15A==
ARC-Authentication-Results: i=2; gmr-mx.google.com;
       dkim=pass header.i=@golang-org.20210112.gappssmtp.com header.s=20210112
       header.b=Xd6DP0u9;
       spf=pass (google.com: domain of r@golang.org designates
       2607:f8b0:4864:20::72e as permitted sender) smtp.mailfrom=r@golang.org;
       dmarc=pass (p=NONE sp=NONE dis=NONE) header.from=golang.org
Sender: golang-dev@googlegroups.com
ARC-Seal: i=1; a=rsa-sha256; t=1634084143; cv=none;
	d=google.com; s=arc-20160816;
	b=VNzQ6UuMhC8hftXAAGfuegrYeR8EhfHVnbgELeXcDRO9qMRhp2fuq2sv2RxuO93N9D
	 gDlMtY2obD/VcnFR667oWd2Vs//+IDxn0Su7tJ94yLxc/ZUw6EogII5xGHcJkaFRJ+rM
	 jIADHz38mAkfVUfMEFErdfebO+Wf8EZENSH49JwN4SurV1YISWArac93rQUo/VWISMJy
	 i+kWrPTf1fe6mNfEnriIq2iAQcvYeGZuHiSyZ/TBYY7eKQx+i9mykTN39Qh8fIfcvPtp
	 oNSLJBWPobFVayxwu0vnhf5ac7KTGiHt4hKG+enfGk4Iz9GJhLbgPN3dWZio5Md0ZvlC
	 tktw==
ARC-Message-Signature: i=1; a=rsa-sha256; c=relaxed/relaxed; d=google.com;
s=arc-20160816;
	h=to:subject:message-id:date:from:mime-version:dkim-signature;
	bh=lzTaUYL1fDNqJI3xX32rMQ54O9ncEJZay8zk5DB9qwE=;
	b=SO62makNfdez0NJxgOED1EJ14l3eYiYhniH10MXC5rSfyx/bx5trhZ072RHwqR28yx
	 pcOoWL/DrdoREenqkSJNUO3ArTwS/IwJVycXnrAWpQfRHqkFPXJMEitz18zRidJDYSuf
	 Y9lLMJnuKPoVd9kCRrPTUGY+CyiIgefppa7gpuI7BycQO4S1vME68nzFMO2pGkuCFgn0
	 gKTkSibbxe+1II29A+b3qT4Qe/qn86BMcI03ZOfoxjTdSD5TOB48gn+anSDrdLHknZ6d
	 DZnsiO3zxPZGUog2fgjoEDskU1UO6NVhDtNY2d3ot/7evUvK113iYqbd/qgAUtrD9ydc
	 sK9A==
ARC-Authentication-Results: i=1; gmr-mx.google.com;
       dkim=pass header.i=@golang-org.20210112.gappssmtp.com header.s=20210112
       header.b=Xd6DP0u9;
       spf=pass (google.com: domain of r@golang.org designates
       2607:f8b0:4864:20::72e as permitted sender) smtp.mailfrom=r@golang.org;
       dmarc=pass (p=NONE sp=NONE dis=NONE) header.from=golang.org
Received-SPF: pass (google.com: domain of r@golang.org designates
2607:f8b0:4864:20::72e as permitted sender) client-ip=2607:f8b0:4864:20::72e;
From: Rob Pike <r@golang.org>
Date: Wed, 13 Oct 2021 11:15:27 +1100
Subject: [golang-dev] help with ivy on ios/mobile
To: golang-dev@googlegroups.com
Mailing-list: list golang-dev@googlegroups.com; contact
golang-dev+owners@googlegroups.com

Ivy (robpike.io/ivy) is the "bignum calculator" that turned into an example
for running Go programs on mobile platforms.  On both Android and iOS, it is
available for download and runs as a Go program wrapped, somewhat clumsily,
by a native (Java or Objective-C) program.  See
golang.org/x/mobile/example/ivy.

The mobile version has had only one minor update since maybe 2015, although
the underlying Go program has become much more robust and rich.  I am in the
process of trying to bring the mobile versions up to scratch.

The biggest technical stumbling block I have is how the demo runs on mobile
(see https://github.com/golang/go/issues/48694).  As a Go program running on
a real OS, one can type

) demo

and get a nice interactive demo.  On mobile, because the I/O is so
constrained, that just doesn't work, and in fact until recent updates the
failure mode was a complaint about a missing Go installation.  That has now
been fixed in the latest ivy build available on GitHub, but the demo
experience is still missing on iOS.

On Android, there is a Demo button that drives the demo and works pretty
well, I think; at least it does in the still-available mobile version.
There is no similar facility available on iOS.

I am not a competent iOS programmer and am looking for a volunteer to help
me add a Demo button, like the one on Android, so that the demo experience
will be available on iOS.  It should be very easy to do for a programmer
skilled in Objective-C.  All that's needed is the glue to connect a screen
button to an existing API in the mobile piece of the existing Go program (
robpike.io/ivy/mobile).

Once this is sorted, I'll make sure Android still works.  Meanwhile I've got
some formatting stuff to do to make the in-program help better on mobile,
and then we can update the mobile apps.

I would be grateful for any assistance.

-rob

--
You received this message because you are subscribed to the Google Groups
"golang-dev" group.
To unsubscribe from this group and stop receiving emails from it, send an email to
golang-dev+unsubscribe@googlegroups.com.
To view this discussion on the web visit
https://groups.google.com/d/msgid/golang-dev/CAOXNBZSWZhSw6Y3NXZpwZ0FG1JpB7yQZNWD%3DDpz%2BYdS-sZdx8g%40mail.gmail.com.




prev | next